DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKACB and Pkg21D

DIOPT Version :9

Sequence 1:NP_891993.1 Gene:PRKACB / 5567 HGNCID:9381 Length:398 Species:Homo sapiens
Sequence 2:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster


Alignment Length:328 Identity:134/328 - (40%)
Similarity:195/328 - (59%) Gaps:9/328 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    60 DRSMKEFLAKAKEDFLKKWENPTQN---NAGLEDFERKKTLGTGSFGRVMLVK--HKATEQYYAM 119
            |.|.|..:.:|:|....:.:...|.   :..|.|.|...|||.|.||||.|||  |:.....:|:
  Fly   423 DESRKLAMKQAQESCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFAL 487

Human   120 KILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIG 184
            |.|.|:.:|..||.||..:|:.|:.:...||:.||...|:|...:||::|...|||:::.||..|
  Fly   488 KCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRG 552

Human   185 RFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLC 247
            .|.:..|:|....::..|||||:..:||||||||||::|.:||:::.||||||::  ..:|||.|
  Fly   553 SFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFC 617

Human   248 GTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFS 310
            |||||:||||||:||:::|||:||||:||:|:..|.|||.|..|:|.|..|:.|  .:.||.|.|
  Fly   618 GTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDMIAFPKHIS 682

Human   311 SDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNF 375
            .....|::.|.:...::|.|....|:.|||.||||...||..:..:.:..||:.......|...|
  Fly   683 RWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYF 747

Human   376 DDY 378
            |.:
  Fly   748 DRF 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKACBNP_891993.1 STKc_PKA 89..378 CDD:271111 127/294 (43%)
Pkg21DNP_477213.1 Crp 183..386 CDD:223736
CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999
Pkinase 457..717 CDD:278497 117/259 (45%)
STKc_cGK 463..724 CDD:270724 119/260 (46%)
S_TK_X 719..>760 CDD:214529 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.