DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKACA and for

DIOPT Version :9

Sequence 1:NP_001291278.1 Gene:PRKACA / 5566 HGNCID:9380 Length:427 Species:Homo sapiens
Sequence 2:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster


Alignment Length:315 Identity:129/315 - (40%)
Similarity:200/315 - (63%) Gaps:14/315 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    98 KAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVK-HKETGNHYAMKILDKQKVVKLKQ 161
            |..|:|         ...:|.....|.|||.|.||||.||: :.::...:|:|.:.|.::|:.:|
  Fly   764 KINEEF---------RDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQ 819

Human   162 IEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQ 226
            .:|.::||.|:...|..|:|||..:|||...|||:||...|||:::.||..|.|.:...|||.|.
  Fly   820 QQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTAC 884

Human   227 IVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK-GR-TWTLCGTPEYLAPEIILS 289
            :|..|:||||.::|||||||||||::::||:::.||||||::: || |||.||||||:|||:||:
  Fly   885 VVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILN 949

Human   290 KGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQV 352
            :|::.:.|:|:||||::|:..|.|||....|::.|..|:.|  .:.||.:.:.:..:|::.|.:.
  Fly   950 RGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRD 1014

Human   353 DLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDY 407
            :..:|.|..:.|:::|:.||||....|..:....:|.|..|..|...||:|||||
  Fly  1015 NPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDY 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKACANP_001291278.1 STKc_PKA 118..407 CDD:271111 123/293 (42%)
S_TKc 120..374 CDD:214567 111/258 (43%)
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736
CAP_ED 638..754 CDD:237999
S_TKc 778..1036 CDD:214567 111/257 (43%)
STKc_cGK 783..1043 CDD:270724 112/259 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.