DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKACA and Pkg21D

DIOPT Version :9

Sequence 1:NP_001291278.1 Gene:PRKACA / 5566 HGNCID:9380 Length:427 Species:Homo sapiens
Sequence 2:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster


Alignment Length:297 Identity:127/297 - (42%)
Similarity:188/297 - (63%) Gaps:6/297 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   117 LDQFERIKTLGTGSFGRVMLVK--HKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPF 179
            |...|.:.|||.|.||||.|||  |::..:.:|:|.|.|:.:|..||.||..:|:.|:.:...||
  Fly   454 LTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPF 518

Human   180 LVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDL 244
            :.:|..:|:|...:||::|...|||:::.||..|.|.:..|:|....::..|||||:..:|||||
  Fly   519 ICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDL 583

Human   245 KPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYE 307
            |||||::|::||:::.||||||::  ..:|||.||||||:||||||:||:::|||:||||:||:|
  Fly   584 KPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHE 648

Human   308 MAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKN 370
            :..|.|||.|..|:|.|..|:.|  .:.||.|.|.....|::.|.:...::|.|....|:.|||.
  Fly   649 LLNGTPPFSAPDPMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKK 713

Human   371 HKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDY 407
            ||||...||..:..:.:..||:.....|.|...||.:
  Fly   714 HKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRF 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKACANP_001291278.1 STKc_PKA 118..407 CDD:271111 126/294 (43%)
S_TKc 120..374 CDD:214567 116/259 (45%)
Pkg21DNP_477213.1 Crp 183..386 CDD:223736
CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999
Pkinase 457..717 CDD:278497 116/259 (45%)
STKc_cGK 463..724 CDD:270724 118/260 (45%)
S_TK_X 719..>760 CDD:214529 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.