DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdh5 and Adhr

DIOPT Version :9

Sequence 1:NP_001025272.1 Gene:rdh5 / 556528 ZFINID:ZDB-GENE-050208-411 Length:328 Species:Danio rerio
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:159 Identity:41/159 - (25%)
Similarity:61/159 - (38%) Gaps:42/159 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish   139 DFESTLKVNMTGVIETTMTFLPLVKK----ARGRIVNVASVLG----RVAANGGGYCISKFAV-- 193
            :.::|:..|:||::.|..|.||.:.:    ..|.||||.||:|    .|..   .|..|||.|  
  Fly   100 NIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFC---AYSASKFGVIG 161

Zfish   194 --ESFSDCLRRDIQGFGVNVCIIEPGFFKTQVTSLEPIERELHRLWNQLTPEVKESYGDKYLDKY 256
              .|.:|.|.....|..|......|    |:|.    ::|||....         .||..:.|: 
  Fly   162 FTRSLADPLYYSQNGVAVMAVCCGP----TRVF----VDRELKAFL---------EYGQSFADR- 208

Zfish   257 IWIQRLIMNAICDSDL---SKVTNCMEHA 282
                  :..|.|.|..   ..:.|.:|.:
  Fly   209 ------LRRAPCQSTSVCGQNIVNAIERS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdh5NP_001025272.1 NADB_Rossmann 40..314 CDD:304358 41/159 (26%)
adh_short 40..224 CDD:278532 29/96 (30%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 41/159 (26%)
adh_short 7..195 CDD:278532 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.