DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A4 and Zip102B

DIOPT Version :9

Sequence 1:NP_570901.3 Gene:SLC39A4 / 55630 HGNCID:17129 Length:647 Species:Homo sapiens
Sequence 2:NP_001284713.1 Gene:Zip102B / 43786 FlyBaseID:FBgn0039902 Length:297 Species:Drosophila melanogaster


Alignment Length:128 Identity:42/128 - (32%)
Similarity:62/128 - (48%) Gaps:27/128 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   500 ITLGDAVHNFADGLAVGAAFASSWK-TGLATSLAVFCHELPHELGDFAALLHAGL---SVRQALL 560
            :|||..||..|||:|:|||..:|.: ..:...||:..|:.|...|....|||..:   .:|:.|:
  Fly   119 LTLGLVVHAAADGVALGAAATTSHQDVEIIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLV 183

Human   561 LNLASA-----LTAFAGLYVALAVGVSEESEAWILAV-ATGL--------FLYVALCDMLPAM 609
            |...||     ||.|         |:.:|.:..:.:| |||:        |||||...:||.:
  Fly   184 LFSLSAPLMTILTYF---------GIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPEL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC39A4NP_570901.3 ZIP4_domain 46..196 CDD:375719
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255
Zip 328..638 CDD:308248 42/128 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..486
Zip102BNP_001284713.1 Zip 18..235 CDD:294300 40/124 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.