Sequence 1: | NP_001139020.1 | Gene: | ZDHHC7 / 55625 | HGNCID: | 18459 | Length: | 345 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651425.2 | Gene: | CG17197 / 43111 | FlyBaseID: | FBgn0039367 | Length: | 290 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 56/206 - (27%) |
---|---|---|---|
Similarity: | 93/206 - (45%) | Gaps: | 34/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Human 130 CGEGTESVQSLLLGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMD 194
Human 195 HHCPWVNNCVGEKNQRFFVLFTMYIALSSVHAL---ILCGFQFISCVRGQWTEC------SDFSP 250
Human 251 PITVILLIFLCLEGLLFFTFTAVMFGTQIH-SICNDETEIERLKSEKPTWERRLRWEGMKSVFGG 314
Human 315 PPSLLWMNPFV 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZDHHC7 | NP_001139020.1 | zf-DHHC | 168..295 | CDD:307600 | 36/136 (26%) |
CG17197 | NP_651425.2 | PHA02688 | <9..70 | CDD:222919 | |
zf-DHHC | 100..>198 | CDD:279823 | 34/108 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |