DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC7 and CG5196

DIOPT Version :9

Sequence 1:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:270 Identity:69/270 - (25%)
Similarity:107/270 - (39%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    72 PSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPEKSSDCRPSACTVKTGLDPTLVGICGEGTES 136
            |:|.| ....:..:|..|:.||..:::...||.|                               
  Fly    40 PNKSF-AGFAHQALFLLLSTLATFNYVMATLTGP------------------------------- 72

Human   137 VQSLLLGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVN 201
                  |.:||....|:      .|..:.:..|.||...|..|:|||..|.||::||||||||:|
  Fly    73 ------GLMPKQWHPKD------PKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWIN 125

Human   202 NCVGEKNQRFFVLFTMYIALSSVH-ALILC---------------GFQFISCVRGQWTECSDFSP 250
            :|||..|..:|..|.::..|.|:. .::||               |...::.|  |:|       
  Fly   126 HCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASV--QFT------- 181

Human   251 PITVILLIFLCLEGL-----LFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKS 310
                :|.|.:|:.|:     :....:.::| .|:.:|.|::|.||....||..: ||.|......
  Fly   182 ----LLSIIMCILGMGLAIGVVIGLSMLLF-IQLKTIVNNQTGIEIWIVEKAIY-RRYRNADCDD 240

Human   311 VFGGPPSLLW 320
            .|..|..|.|
  Fly   241 EFLYPYDLGW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 45/147 (31%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 45/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.