DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC7 and Hip14

DIOPT Version :9

Sequence 1:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens
Sequence 2:NP_001261910.1 Gene:Hip14 / 39747 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster


Alignment Length:321 Identity:72/321 - (22%)
Similarity:111/321 - (34%) Gaps:105/321 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    35 VADRVWFIRDGCGMICAVMTWLLVAYAD----FVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALS 95
            :|.:.||          .:|||:  |.|    |..|...|:.|...|      |.|         
  Fly   356 LATKAWF----------YVTWLM--YIDDAVSFTATVCFLISSLLLW------VCF--------- 393

Human    96 SHLRTMLTDPEKSSDCRPSACTVKTGLDPTLVGICGEGTESVQSLLLGAVPKGNATKEYMESLQL 160
              |::...||                      ||.....|.....::....:|        .:..
  Fly   394 --LKSWKGDP----------------------GIIRPTREQRFKTIIELSERG--------GIGF 426

Human   161 KPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVH 225
            :|...   |..|...:|.|:.|||:|.||:.:.|||||||.||:|.||..:|:.|...:      
  Fly   427 EPASF---CSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGFLWML------ 482

Human   226 ALILCGFQFISCVRGQWTECS----DFSPPITVI-----LLIFLCLEGLLFFTFTAVMFGTQIHS 281
             ||:|.:......:....:|:    ||...:..|     .:.::....||..::..::...|.:.
  Fly   483 -LIMCAWMLYGGSKYYVNQCNVRFDDFLGAMRAIGNCDAWVGWVMGNALLHMSWVILLTICQTYQ 546

Human   282 -ICNDETEIERLKSEKPTWERRLRWEGMKSVF-GGPPSLL------------------WMN 322
             ||...|..||:...:   .|..:.:|..|.| .||...|                  |||
  Fly   547 VICLGMTTNERMNRGR---YRHFQAKGGHSPFTRGPIQNLVDFLECSCFGLVQPKRVDWMN 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 39/136 (29%)
Hip14NP_001261910.1 ANK 52..165 CDD:238125
Ank_2 52..142 CDD:289560
ANK repeat 77..108 CDD:293786
ANK repeat 110..142 CDD:293786
ANK 114..233 CDD:238125
Ank_2 116..209 CDD:289560
ANK repeat 144..175 CDD:293786
ANK repeat 177..209 CDD:293786
Ank_5 198..251 CDD:290568
ANK repeat 212..244 CDD:293786
zf-DHHC 426..559 CDD:279823 40/142 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.