DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC7 and CG17287

DIOPT Version :9

Sequence 1:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:112/278 - (40%) Gaps:84/278 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    50 CAVMTWL--------LV-AYADFV-----------VTFVMLLPSKDFWYSVVNGVIFNCLAVLAL 94
            |..:.||        || :|..||           :|..:||    |:|        :.|..:.|
  Fly    13 CCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLL----FFY--------HLLLFMFL 65

Human    95 SSHLRTMLTDPEKSSDCRPSACTVKTGLDPTLV-------GICGEGTESVQSLLLGAVPKGNATK 152
            .:..|.:...|.:..|        :..:.|..|       ||  ||...|.:.....:|....|.
  Fly    66 WTWFRCIFVAPVRIPD--------QWKISPEDVDKLKRNDGI--EGASRVLNYAARNLPIATCTI 120

Human   153 EYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM 217
            :         |.|.| |..|..|||:|||||..|..|:.||||||||:.|||...|.::|:||..
  Fly   121 D---------GLVRY-CKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLF 175

Human   218 YIALSSVHAL--------ILCGFQFISCVRGQ--WTECSDFSPPITVILLIFLCLEGLLFFTFTA 272
            |..:...:..        ::|||: ::.::.|  |.           ||...:|   :||..||.
  Fly   176 YAEVYCFYLFCVMVYDLYLICGFE-VTALKNQHSWN-----------ILQYLVC---ILFNIFTV 225

Human   273 VMFGTQIHSICNDETEIE 290
            :|:...:.::..:.|.:|
  Fly   226 IMYTVSLLNVSRNRTTME 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 43/133 (32%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 43/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157920
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.