DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC7 and CG8314

DIOPT Version :9

Sequence 1:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens
Sequence 2:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster


Alignment Length:288 Identity:142/288 - (49%)
Similarity:187/288 - (64%) Gaps:38/288 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    37 DRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTM 101
            ::.|.::|.||::|.:|||||:.:|:|||..::||||....:|.:|.:||..||.||.:||:|||
  Fly    28 NKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTM 92

Human   102 LTDPEKSSDCRPSACTVKTGLDPTLVGICGEGTESVQSLLLGAVPKGNATKEYMESLQLKPGEVI 166
            |:||                                     ||||:||||||.:|.:..:.|::.
  Fly    93 LSDP-------------------------------------GAVPRGNATKEMIEQMGYREGQMF 120

Human   167 YKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCG 231
            |||||||.||||||||||:|:|||||||||||||||||||.||::|||||.|||..|||.|.|..
  Fly   121 YKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVL 185

Human   232 FQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEK 296
            .||..||:..|..||.:|||.|:.||:||..|||:|..||.:|..||:.:|.||:|.||:||.|:
  Fly   186 TQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEE 250

Human   297 PTWERRLRWEGMKSVFGGPPSLLWMNPF 324
            ..|.::.|.:.::||| |..||.|.:||
  Fly   251 ARWAKKSRLKSIQSVF-GRFSLAWFSPF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 83/126 (66%)
CG8314NP_611070.1 DHHC 122..249 CDD:396215 83/126 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 204 1.000 Domainoid score I2955
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 351 1.000 Inparanoid score I2276
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49015
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 1 1.000 - - FOG0001671
OrthoInspector 1 1.000 - - otm40991
orthoMCL 1 0.900 - - OOG6_104274
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2063
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.