DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC7 and CG17075

DIOPT Version :9

Sequence 1:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:182 Identity:45/182 - (24%)
Similarity:83/182 - (45%) Gaps:43/182 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    52 VMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLAL---SSHLRTMLTDPEKSSDCRP 113
            :..||::.... |.::.:|:|:   :::.:.|.::..:..|.|   :|||..:||||        
  Fly   115 IFGWLVLLLFG-VASYWVLIPA---FHARIQGPLYGLITGLYLVHIASHLTALLTDP-------- 167

Human   114 SACTVKTGLDPTLVGICGEGTESVQSLLLGAVPKGNATKEYMESLQLKPGEVIYKCPKC-CCIKP 177
                    .|..|..:  ...:.:       ||:.:.:|   .|..::.|    :|..| .....
  Fly   168 --------ADKELRRV--HRNDRI-------VPEFDRSK---HSHVIENG----RCHLCNIRTSS 208

Human   178 ERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALIL 229
            .|..|||:|.:|:.|.||||.|:|:|:|.:|   :|.|.|.:..:.|..|::
  Fly   209 NRTKHCSVCNKCVGKFDHHCKWLNHCIGSRN---YVAFLMCVVSAVVATLVI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 23/63 (37%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.