| Sequence 1: | NP_001365368.1 | Gene: | KIF21A / 55605 | HGNCID: | 19349 | Length: | 1675 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_014392.3 | Gene: | LST8 / 855726 | SGDID: | S000004951 | Length: | 303 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 261 | Identity: | 67/261 - (25%) |
|---|---|---|---|
| Similarity: | 109/261 - (41%) | Gaps: | 43/261 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Human 1426 LTSSG---QVTLGDACSASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRF--QS 1485
Human 1486 TGKLTGHLGPVMCLTVDQISSGQD--LIITGSKDHYIKMFDVTEGALGTVSPT--HNFEPPHYDG 1546
Human 1547 IEALTI---QGDNLFSGSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGI 1608
Human 1609 LKVWNMDT------FMPVGEMKGHDSPINAICVNS--THIFTAADDRTVRIW------KARNLQD 1659
Human 1660 G 1660 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| KIF21A | NP_001365368.1 | KISc_KIF4 | 8..372 | CDD:276823 | |
| Cast | <364..836 | CDD:401982 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 556..641 | ||||
| Smc | <644..1004 | CDD:224117 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 779..804 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 841..881 | ||||
| Rcc_KIF21A | 936..1017 | CDD:410204 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1116..1138 | ||||
| Interaction with KANK1 and KANK2. /evidence=ECO:0000269|PubMed:29183992 | 1146..1167 | ||||
| WD40 | 1340..1653 | CDD:238121 | 64/252 (25%) | ||
| WD 1 | 1346..1383 | ||||
| WD 2 | 1386..1424 | ||||
| WD40 repeat | 1391..1450 | CDD:293791 | 8/26 (31%) | ||
| WD 3 | 1450..1488 | 7/39 (18%) | |||
| WD40 repeat | 1456..1491 | CDD:293791 | 6/36 (17%) | ||
| WD 4 | 1491..1533 | 14/43 (33%) | |||
| WD40 repeat | 1496..1540 | CDD:293791 | 14/47 (30%) | ||
| WD 5 | 1542..1579 | 12/39 (31%) | |||
| WD40 repeat | 1548..1581 | CDD:293791 | 12/35 (34%) | ||
| WD 6 | 1583..1622 | 9/44 (20%) | |||
| WD40 repeat | 1588..1624 | CDD:293791 | 9/41 (22%) | ||
| WD 7 | 1625..1662 | 13/44 (30%) | |||
| LST8 | NP_014392.3 | WD40 | 4..278 | CDD:238121 | 67/261 (26%) |
| WD40 repeat | 36..73 | CDD:293791 | 6/36 (17%) | ||
| WD40 repeat | 78..114 | CDD:293791 | 14/42 (33%) | ||
| WD40 repeat | 120..155 | CDD:293791 | 12/35 (34%) | ||
| WD40 repeat | 162..204 | CDD:293791 | 9/41 (22%) | ||
| WD40 repeat | 210..247 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 253..277 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||