DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIF21A and CAF4

DIOPT Version :9

Sequence 1:NP_001365368.1 Gene:KIF21A / 55605 HGNCID:19349 Length:1675 Species:Homo sapiens
Sequence 2:NP_012962.3 Gene:CAF4 / 853908 SGDID:S000001744 Length:643 Species:Saccharomyces cerevisiae


Alignment Length:434 Identity:115/434 - (26%)
Similarity:181/434 - (41%) Gaps:106/434 - (24%)


- Green bases have known domain annotations that are detailed below.


Human  1283 ELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHSRSSRRGIINPFPASKGIRAFPLQCIHIAEGH 1347
            |.||.| |::   |.:::.|:....||.::|:.||.                      :.|.|  
Yeast   169 ETNVEN-LSI---NKTLEMDELTRLDSMINELESRK----------------------LKILE-- 205

Human  1348 TKAVLCVDSTDDLL---FTGSKDRT--CKVWNLVTGQEIMSLGGHPNNVVSVKYCNYT------S 1401
              .|..:||....|   .|..|||.  .:.:||...:| .||........|.:..::|      |
Yeast   206 --RVKHIDSKSTNLENDVTLIKDRINFIEEYNLEADRE-QSLRKQMEEERSSEASSFTQNEEAIS 267

Human  1402 LVFTVSTSYIKVWDI--------RDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGENQINQI 1458
            .:..|.:...::.|.        .|..:.|.:.|.|..         :|:..:.||.||:..:..
Yeast   268 SLCDVESKDTRLKDFYKMPHEKSHDKNRQIISETYSRN---------TTAFRMTIPHGEHGNSIT 323

Human  1459 ALN---PTGTFLYAA-SGNAVRMWDLKRFQSTGKLTGHLGPVMCLTVDQISSGQDLIITGSKDHY 1519
            ||:   |.||...:: ....|::|||......|:|.|||..|.|:.:|:  ...:::||||||..
Yeast   324 ALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDK--KNYNMLITGSKDAT 386

Human  1520 IKMFDVT-------------EGALGTVSP-THNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWD 1570
            :|::|:.             |.....|:| .|||| .|.|.|.||:...:.|.|||||..|..||
Yeast   387 LKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFE-LHKDEITALSFDSEALVSGSRDKKIFHWD 450

Human  1571 LTQKDLLQQV----PNAHKD----------WVCALGVVPDHPV----------LLSGCRGGILKV 1611
            ||....:||:    ...|.|          ..|.||.  :.|:          |.:|.:.||:::
Yeast   451 LTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGT--EAPMIGALQCYNSALATGTKDGIVRL 513

Human  1612 WNMDTFMPVGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKAR 1655
            |::....||..::||...|.::..:|..:.|.:.|.:||||..|
Yeast   514 WDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLR 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KIF21ANP_001365368.1 KISc_KIF4 8..372 CDD:276823
Cast <364..836 CDD:401982
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..641
Smc <644..1004 CDD:224117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 779..804
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 841..881
Rcc_KIF21A 936..1017 CDD:410204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1116..1138
Interaction with KANK1 and KANK2. /evidence=ECO:0000269|PubMed:29183992 1146..1167
WD40 1340..1653 CDD:238121 101/373 (27%)
WD 1 1346..1383 11/41 (27%)
WD 2 1386..1424 6/51 (12%)
WD40 repeat 1391..1450 CDD:293791 11/72 (15%)
WD 3 1450..1488 11/41 (27%)
WD40 repeat 1456..1491 CDD:293791 11/38 (29%)
WD 4 1491..1533 15/54 (28%)
WD40 repeat 1496..1540 CDD:293791 16/57 (28%)
WD 5 1542..1579 16/36 (44%)
WD40 repeat 1548..1581 CDD:293791 15/36 (42%)
WD 6 1583..1622 13/58 (22%)
WD40 repeat 1588..1624 CDD:293791 11/45 (24%)
WD 7 1625..1662 11/31 (35%)
CAF4NP_012962.3 Caf4 65..124 CDD:402971
WD40 318..641 CDD:238121 74/245 (30%)
WD40 repeat 322..360 CDD:293791 11/37 (30%)
WD40 repeat 366..422 CDD:293791 17/58 (29%)
WD40 repeat 427..461 CDD:293791 16/33 (48%)
WD40 repeat 472..526 CDD:293791 11/55 (20%)
WD40 repeat 532..563 CDD:293791 9/26 (35%)
WD40 repeat 571..611 CDD:293791
WD40 repeat 617..641 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.