DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2Q1 and CG4502

DIOPT Version :10

Sequence 1:NP_060052.3 Gene:UBE2Q1 / 55585 HGNCID:15698 Length:422 Species:Homo sapiens
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:208 Identity:94/208 - (45%)
Similarity:135/208 - (64%) Gaps:21/208 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   228 AILEKIKKNQRQDY---------LNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSL 283
            |:.:...|.:|||:         |..|...::: |.|||||.|::.|.|:.....:.||||||||
  Fly   107 AVWDSPGKRRRQDHKVAPTTERQLVAAPDHTIR-TRRLMKEYREMERLQAKNDAVFTVELVNDSL 170

Human   284 YDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGG 348
            ::|:|:|..:|.||.|..|:    .:.|...|||:.||.|||||.|||:|||.|.:..|||:.||
  Fly   171 FEWHVRLHVIDPDSPLARDM----AEMGVPAILLHLSFPDNFPFAPPFMRVVEPHIEKGYVMEGG 231

Human   349 AICMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANK----SQYSLTRAQQSYKSLVQIH 409
            ||||||||.:||:|||::|:||||.:|::|||:.|:   |.|    .:::..:|::|::|||:.|
  Fly   232 AICMELLTPRGWASAYTVEAVIMQFAASVVKGQGRI---ARKPKSTKEFTRRQAEESFRSLVKTH 293

Human   410 EKNGWYTPPKEDG 422
            ||.||.||...||
  Fly   294 EKYGWVTPALSDG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2Q1NP_060052.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..221
UBCc_UBE2Q 254..409 CDD:467422 77/158 (49%)
CG4502NP_609103.1 UBCc_UBE2Q 141..293 CDD:467422 77/158 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.