DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM38 and Rbm38

DIOPT Version :9

Sequence 1:NP_001278709.1 Gene:RBM38 / 55544 HGNCID:15818 Length:271 Species:Homo sapiens
Sequence 2:NP_062420.2 Gene:Rbm38 / 56190 MGIID:1889294 Length:237 Species:Mus musculus


Alignment Length:271 Identity:226/271 - (83%)
Similarity:230/271 - (84%) Gaps:34/271 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     1 MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVV 65
            |||||| |:||. ||||.|||.|||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MLLQPA-CSPSV-FPRPSAAPSAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVV 63

Human    66 ITDRQTGKSRGYGFGIIFVLEGHISQALNFDGRSWNPGGIFVGEPQVTMADRAAAERACKDPNPI 130
            ||||||||||||||                                |||||||||:|||||||||
Mouse    64 ITDRQTGKSRGYGF--------------------------------VTMADRAAADRACKDPNPI 96

Human   131 IDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVP 195
            |||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||.|||
Mouse    97 IDGRKANVNLAYLGAKPRSLQTGFAVGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPATPVP 161

Human   196 SLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQY 260
            ||||||:|||||||||||||||||||||||||||.|.|||||.||||||||||||||||||||||
Mouse   162 SLSSPYLEYTPASPAYAQYPPATYDQYPYAASPAAATSFVGYGYPAAVPQALSAAAPAGTTFVQY 226

Human   261 QAPQLQPDRMQ 271
            |||||||||||
Mouse   227 QAPQLQPDRMQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM38NP_001278709.1 RRM_RBM24_RBM38_like 34..141 CDD:409818 73/106 (69%)
PABP-1234 <46..269 CDD:130689 183/222 (82%)
Rbm38NP_062420.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 18/24 (75%)
RRM_RBM24_RBM38_like 32..107 CDD:240830 73/106 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83966257
Domainoid 1 1.000 292 1.000 Domainoid score I16685
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H79543
Inparanoid 1 1.050 459 1.000 Inparanoid score I12825
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG40910
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001012
OrthoInspector 1 1.000 - - oto126297
orthoMCL 1 0.900 - - OOG6_105204
Panther 1 1.100 - - LDO PTHR48024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1414.400

Return to query results.
Submit another query.