DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SVOP and CG33233

DIOPT Version :9

Sequence 1:NP_061181.1 Gene:SVOP / 55530 HGNCID:25417 Length:548 Species:Homo sapiens
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:506 Identity:100/506 - (19%)
Similarity:197/506 - (38%) Gaps:93/506 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    70 VEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMM 134
            |:.|:..||:|..|..:.:::...:|....|.|....|.....||:.....:..||.:.:..||:
  Fly     6 VDTALLTIGYGLGQVIIFMVSFFIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMV 70

Human   135 SSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAP-VYSWILVLRGLVGFGIGGVPQ-SVTLY 197
            :|....|.::|:||||..::::::..|.:.::||..| :|| :.|:|.:||..:..|.. .|...
  Fly    71 ASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYS-LSVIRIIVGTFLSAVASLQVGFL 134

Human   198 AEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPS------------LGWRWLLILSAVPLLL 250
            .||..:|.|...:.:......:..::..::|:.::|:            ..||:|::...:|..|
  Fly   135 GEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWL 199

Human   251 FAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRW 315
            ..|....:||:..:.:.....:||:..||.|...|........:.:|.::.....::.|     |
  Fly   200 ALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGF-----W 259

Human   316 TTLLLWF---IWFS--NAFSYYGLVLLTTELF--------------------------------- 342
            .|  :|:   :.||  :.|.::..:.|...:|                                 
  Fly   260 KT--VWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPT 322

Human   343 ----QAGDVCGISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTM 403
                :|.|..|..|.    ..||:.....|.:..|....:........|||. |    :.||..:
  Fly   323 FINHEADDTNGTDSE----SPKCNDEMTNLIDPVYYGFTYIGCFILASVLVH-W----MTRKYVI 378

Human   404 ALCFVIFSFCSLLLFICVG---RNVLTLLLFIARAFISGGFQAAYVYTP-------EVYPTATRA 458
            ||..:|    |::|.|.:.   :..:.|:.|:....:.|      |..|       :..|...|.
  Fly   379 ALHILI----SMILGISLNIMKQPTVVLIFFVLMMVLPG------VLIPLATSVLVDCLPVNLRG 433

Human   459 LGLGTCSGMARVGALITPFIAQVMLESSVYLTLAVYSGCCLLAALASCFLP 509
            ..|.....:||.|.::...:..:.:..:..:|..:::.|..:..:.:.|.|
  Fly   434 KALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SVOPNP_061181.1 MFS_SVOP 87..509 CDD:340999 93/487 (19%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 90/455 (20%)
MFS 23..>208 CDD:119392 41/185 (22%)
MFS 354..>482 CDD:304372 25/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.