DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tspearb and clos

DIOPT Version :9

Sequence 1:XP_682770.2 Gene:tspearb / 555223 ZFINID:ZDB-GENE-030131-4270 Length:666 Species:Danio rerio
Sequence 2:NP_001097246.3 Gene:clos / 5740204 FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster


Alignment Length:236 Identity:65/236 - (27%)
Similarity:110/236 - (46%) Gaps:35/236 - (14%)


- Green bases have known domain annotations that are detailed below.


Zfish   399 QSVIYKWSSKKLKFIRYQTLITHSARDWEAFNIQDETFLAVANHRQGERNHNIDSVIYKWNQVTQ 463
            |...:||..|  .|.|...:....||..|||.|....::||||:...|......|.|::|:..:|
  Fly   200 QCPYFKWMGK--SFQRLGAIHCSKARRMEAFGIDYTDYVAVANYADAEGRTATHSEIFRWDAKSQ 262

Zfish   464 FFEVNQTIPTAGAYDWEFFA-----VGPYYFLVVANTFNGRSTVI---DSTIYIWLGGMFQPYQS 520
            .|::.|.:.:.||.|.::|:     |...:||::.||..|....:   |:.||::..|.|.|||.
  Fly   263 RFQLFQRLRSNGAVDVKYFSLPVNEVSRRHFLILGNTIGGTGAEVGDADTVIYVFEKGQFVPYQR 327

Zfish   521 ITTFGAIDWEM---FQIENRVFLAVA-NSQMLTEEGKILYSINSTIYELSMTSQTFVRFQDIETN 581
            : :|.|::..:   ..|..:..|.|| |.|.:.     :|::|...:|     ::.|:|    |.
  Fly   328 L-SFYALERVLPVQHSISEKFLLLVACNKQDVK-----IYNLNDWRFE-----ESKVQF----TE 377

Zfish   582 SALD-----WEYFTVGDDKFLVVAN-SYDGNSYSLNSVIYR 616
            .||.     ...:..||..:||:|| :...|..::...:|:
  Fly   378 GALSRGVARMRSYEEGDQSYLVIANENMAANETNIFQPLYK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tspearbXP_682770.2 LamG 64..218 CDD:304605
EPTP 358..406 CDD:281697 2/6 (33%)
EPTP 411..459 CDD:281697 15/47 (32%)
EPTP 465..510 CDD:281697 15/52 (29%)
EPTP 514..564 CDD:281697 14/53 (26%)
EPTP 572..617 CDD:281697 13/51 (25%)
EPTP 622..662 CDD:281697
closNP_001097246.3 EPTP 263..315 CDD:281697 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.