DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MACROH2A2 and His2A:CG33829

DIOPT Version :9

Sequence 1:NP_061119.1 Gene:MACROH2A2 / 55506 HGNCID:14453 Length:372 Species:Homo sapiens
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:123 Identity:81/123 - (65%)
Similarity:92/123 - (74%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSGR--SGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILEL 63
            ||||  .||.|....|||.|||:.|||||:.|.|:||.:..|:..|||||:|||:||||||:|||
  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65

Human    64 AGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTK 121
            ||||||||||.||.|||:.||:.||||||:||.|||||.|||||.|...||.||...|
  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MACROH2A2NP_061119.1 H2A 5..117 CDD:238029 74/111 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..182 3/7 (43%)
Macro_H2A-like 178..368 CDD:394875
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 74/108 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.