| Sequence 1: | NP_002716.1 | Gene: | PRELP / 5549 | HGNCID: | 9357 | Length: | 382 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
| Alignment Length: | 287 | Identity: | 85/287 - (29%) |
|---|---|---|---|
| Similarity: | 131/287 - (45%) | Gaps: | 39/287 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Human 107 LYLQNNFITELPVESFQNATGLRWINLDNNRIRKIDQRVLEKLPGLVFLYMEKNQLEEVPSALPR 171
Human 172 NLEQ---LRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDGVFKPDTFHGLKNLMQLNLAHNIL 233
Human 234 RKMPPRVPT---AIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYN---KLTDRGLPKNSFNISN 292
Human 293 LLVLHLSHNRISSVP----AINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLR 353
Human 354 YLRLDGNYLKPPIPLDLMMCFRLLQSV 380 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PRELP | NP_002716.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 19..66 | ||
| LRRNT | 72..107 | CDD:214470 | 85/287 (30%) | ||
| LRR 1 | 95..114 | 3/6 (50%) | |||
| LRR_8 | 102..162 | CDD:316378 | 18/54 (33%) | ||
| leucine-rich repeat | 104..127 | CDD:275380 | 7/19 (37%) | ||
| LRR 2 | 115..138 | 7/22 (32%) | |||
| leucine-rich repeat | 128..151 | CDD:275380 | 7/22 (32%) | ||
| NEL | <133..>353 | CDD:330839 | 65/232 (28%) | ||
| LRR 3 | 139..162 | 6/22 (27%) | |||
| leucine-rich repeat | 152..172 | CDD:275380 | 6/19 (32%) | ||
| LRR 4 | 163..183 | 5/22 (23%) | |||
| leucine-rich repeat | 173..196 | CDD:275380 | 7/25 (28%) | ||
| LRR 5 | 184..207 | 6/22 (27%) | |||
| leucine-rich repeat | 197..222 | CDD:275380 | 9/24 (38%) | ||
| LRR 6 | 208..233 | 9/24 (38%) | |||
| leucine-rich repeat | 223..243 | CDD:275380 | 9/22 (41%) | ||
| LRR 7 | 234..254 | 6/22 (27%) | |||
| leucine-rich repeat | 244..267 | CDD:275380 | 4/22 (18%) | ||
| LRR 8 | 255..278 | 2/25 (8%) | |||
| leucine-rich repeat | 268..292 | CDD:275380 | 5/26 (19%) | ||
| LRR 9 | 279..303 | 7/23 (30%) | |||
| LRR 10 | 304..323 | 7/22 (32%) | |||
| LRR 11 | 324..362 | 11/37 (30%) | |||
| LRR 12 | 363..382 | 6/18 (33%) | |||
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | 3/6 (50%) | ||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | 7/19 (37%) | ||
| LRR_RI | 115..384 | CDD:238064 | 85/287 (30%) | ||
| LRR_8 | 135..195 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..243 | CDD:290566 | 20/60 (33%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 9/24 (38%) | ||
| LRR_8 | 232..289 | CDD:290566 | 14/56 (25%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 280..339 | CDD:290566 | 17/62 (27%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 5/26 (19%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 7/22 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45712 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||