DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIRPG and nitr1i

DIOPT Version :9

Sequence 1:NP_061026.2 Gene:SIRPG / 55423 HGNCID:15757 Length:387 Species:Homo sapiens
Sequence 2:NP_571721.1 Gene:nitr1i / 60644 ZFINID:ZDB-GENE-001106-3 Length:335 Species:Danio rerio


Alignment Length:234 Identity:58/234 - (24%)
Similarity:87/234 - (37%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    12 GPFLLLT----LLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTV---TSLLPVGPVLWFRG 69
            |..|::|    |||..| :....:..::|.:.:.:|..|......||.   |.|..|    ||:.
Zfish    11 GRRLIVTCYFILLLSST-IFCSTDFDVVQEDNVKIVKAGWDVKFTCTFSWHTQLKKV----WFKQ 70

Human    70 VGPGREL----IY-NQKEGHFPRV--TTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSP 127
            ...|:.|    :| :||....|:.  |...:..|.:|. |::.|...|.:|..|||||       
Zfish    71 TNNGKSLQIVSLYGSQKPSWNPKFEKTNRFNAAKGDNF-FNLTILKTTLSDSATYYCV------- 127

Human   128 ENVEFKSGPGTEMALGAKPSAPVVLGPAARTT-----------PEHTVSFTCESHGFS-PRDITL 180
                ..|...|.|..|.:  ..|....|.|.|           |..:|:..|.....| ..|.::
Zfish   128 ----VSSYQATGMGSGTR--LLVRDADADRNTTLHQSLIDAVDPGDSVNLQCSIFTESCAGDHSI 186

Human   181 KWFK--NGNELSDFQTNVDPTG----------QSVAYSI 207
            .|||  :|:.:....|..:..|          ||..||:
Zfish   187 YWFKQISGDSVGLIYTKGERNGRCKNSTESQTQSCVYSL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIRPGNP_061026.2 IgV_SIRP 33..143 CDD:319346 31/119 (26%)
IgC_SIRP_domain_2 145..248 CDD:319314 19/87 (22%)
IgC_SIRP_domain_3 250..353 CDD:319334
nitr1iNP_571721.1 V-set 45..145 CDD:284989 31/117 (26%)
IG_like 45..144 CDD:214653 31/116 (27%)
IG_like 163..242 CDD:214653 15/63 (24%)
V-set 165..259 CDD:284989 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm28671
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.