DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIRPG and side

DIOPT Version :9

Sequence 1:NP_061026.2 Gene:SIRPG / 55423 HGNCID:15757 Length:387 Species:Homo sapiens
Sequence 2:NP_001247334.1 Gene:side / 43300 FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster


Alignment Length:407 Identity:95/407 - (23%)
Similarity:161/407 - (39%) Gaps:84/407 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    15 LLLTLLLGLTEVAGEEELQMIQ---PEKLLLVTVGKTATLHCTV---TSLLPVGPVLWFRGVGPG 73
            :|||.|..|..|:.:||.|..|   |.:|:...:|||..|.|.:   ||...|..:|||:.. .|
  Fly    71 VLLTCLQQLKSVSADEESQDFQKNIPARLVWAALGKTVELPCDLTPPTSQDSVKLLLWFKDT-TG 134

Human    74 RELIYNQKEGH----FPRVTTVSDLTKR-------NNMDFSIRISSITPADVGTYYCVKFRKGSP 127
            ..|......|.    .|.....|||.:|       |..|..::|:.:.|.|.|.|.|        
  Fly   135 IPLYSLDSRGGNVKLAPHAAIASDLGQRLFFSIGDNPKDSRLQINDVKPEDGGVYRC-------- 191

Human   128 ENVEFKSGPGT----EMALGAKPSAPVVLGPAARTTPE--------HTVSFTCESHGFSPRDITL 180
             .|:|.:.|..    .:.|...|..|.:.....:...:        :.:...|:..|..|.. .:
  Fly   192 -RVDFFNSPTRNFRHNLTLVVPPEEPRIFDAQGKEISQMAGPFREGYELFLCCQVRGGRPPP-KV 254

Human   181 KWFKNGNEL-SDFQTNVDPTGQSVAYS---IRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRGT 241
            .|:::..|| ....|:|: .|.:|..:   |.:|.|   |.:.:|  :.|..          :||
  Fly   255 TWWRDDTELIGTSHTSVE-EGATVMVNQLLIGTTTR---DFYGIR--IECRA----------QGT 303

Human   242 ANLSEAIRVPPTLEVTQQPMRV-----------GNQVNVTCQVRKFYPQSLQLTWSENGNVCQRE 295
             .|.:.:|...|::|..:|:||           |..:.:.|:....|| :.::||..:|...:..
  Fly   304 -RLVDPVRKDVTVQVYLKPVRVKIATPNELLTAGQPMPIRCESWGSYP-AAKITWLLDGEPIRNA 366

Human   296 TASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVKH---DGQLAVSKRLAL-----EVTVH-- 350
            ..:..::.:||... ||...:.::.:.|:..|||:..:   .|.....||:..     .|:||  
  Fly   367 EVTVHSDKEDGNIT-TSILTLKVTSENDNAELTCRATNPWFSGGAIEDKRIIRVAYPPTVSVHLA 430

Human   351 QKDQSSDATPGPASSLT 367
            .:|.|...|.....::|
  Fly   431 NEDPSRLVTRAEGQNVT 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIRPGNP_061026.2 IgV_SIRP 33..143 CDD:319346 34/130 (26%)
IgC_SIRP_domain_2 145..248 CDD:319314 21/114 (18%)
IgC_SIRP_domain_3 250..353 CDD:319334 26/123 (21%)
sideNP_001247334.1 V-set 95..211 CDD:284989 33/125 (26%)
IG_like 100..211 CDD:214653 31/120 (26%)
Ig 235..301 CDD:299845 16/82 (20%)
Ig 326..408 CDD:299845 15/83 (18%)
IG_like 329..407 CDD:214653 15/79 (19%)
IG_like 435..511 CDD:214653 3/13 (23%)
Ig_2 442..511 CDD:290606 1/6 (17%)
FN3 <700..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.