DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIRPG and beat-IV

DIOPT Version :9

Sequence 1:NP_061026.2 Gene:SIRPG / 55423 HGNCID:15757 Length:387 Species:Homo sapiens
Sequence 2:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster


Alignment Length:217 Identity:43/217 - (19%)
Similarity:82/217 - (37%) Gaps:42/217 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   180 LKWFKNGNELSDF-------QTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVI--CEVA-----H 230
            :||:|:..|...:       :|:....|..|...:...:||:|....:.|..:  |||:     .
  Fly   214 IKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEVSAEAPNF 278

Human   231 VTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRE 295
            .::||:   |..::....|..|.:...|...::|..:.:.|...|.:|.| .|.|..|       
  Fly   279 SSVQGE---G
RMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPAS-HLQWFVN------- 332

Human   296 TASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVK--------HDGQLAVSKRLALEVTVHQ- 351
            ....|.|:....||       :|..:...:..|..::        |:|.:.|....::...:.: 
  Fly   333 EQPILDEHYLHKYN-------DIVHKHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKG 390

Human   352 -KDQSSDATPGPASSLTALLLI 372
             |:......||...:..|:||:
  Fly   391 GKESVLQRRPGIIDNREAMLLV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIRPGNP_061026.2 IgV_SIRP 33..143 CDD:319346
IgC_SIRP_domain_2 145..248 CDD:319314 17/81 (21%)
IgC_SIRP_domain_3 250..353 CDD:319334 19/112 (17%)
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 16/73 (22%)
Ig 314..>362 CDD:299845 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.