DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIRPG and beat-Ia

DIOPT Version :9

Sequence 1:NP_061026.2 Gene:SIRPG / 55423 HGNCID:15757 Length:387 Species:Homo sapiens
Sequence 2:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster


Alignment Length:200 Identity:45/200 - (22%)
Similarity:75/200 - (37%) Gaps:35/200 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   179 TLKWFKNGNELSDFQTNVDP-------TGQSVAYSIRSTARVVLDPWDVRS--QVICEVAHVTLQ 234
            ::||:|...|...:.....|       .|..|.....:.::||||...:.:  :..|||:.....
  Fly    59 SVKWYKGRREFYRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPS 123

Human   235 GDPLRGTANLSEAIRVP---PTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQ--- 293
            ...|...|.| |.|..|   |.:...:...|||:.:...|..|...| :..|||:.|.....   
  Fly   124 FHTLIAAAEL-EVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRP-AANLTWTVNNEEVNPAL 186

Human   294 -------RETASTLTENKDGTYNWTSWFLVNISDQRDD---VVLTCQVK-HDGQLAVSKRLALEV 347
                   |:..:.:.....|.:     |:|  :||..|   :.|.|..: ||.....::::.||.
  Fly   187 VRHHKILRDARNDMETAVVGIH-----FVV--TDQHFDNGKLKLRCSAQLHDVYWKTTEKIILET 244

Human   348 TVHQK 352
            .:..|
  Fly   245 DLFPK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIRPGNP_061026.2 IgV_SIRP 33..143 CDD:319346
IgC_SIRP_domain_2 145..248 CDD:319314 18/77 (23%)
IgC_SIRP_domain_3 250..353 CDD:319334 25/119 (21%)
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 13/58 (22%)
Ig 161..240 CDD:299845 18/86 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.