DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psma2a and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_001019612.1 Gene:psma2a / 554153 ZFINID:ZDB-GENE-050522-479 Length:234 Species:Danio rerio
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:216 Identity:78/216 - (36%)
Similarity:126/216 - (58%) Gaps:8/216 - (3%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKV 65
            |:.| |..:||.|||.|.|:|:|||..||..|:.:||::.:|.|||..||...|.:.::::|.|:
  Fly     1 MSSR-YGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKI 64

Zfish    66 EPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPF 130
            ..:.:|:.:.::|:..|.|:|:.|.:...|.:.|.::..:....:.:.:|.:.|:|||..|.|||
  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129

Zfish   131 GVSLLIAGWDED-RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELE---DAIHTA 191
            |:|.||.|.|.| ...||.::|||.:..:||||.|:.....:.|.||.|: |.|:.   |||..|
  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYS-DHEVTTKCDAIKLA 193

Zfish   192 ILTLKESFEGQMTEDNIEVGI 212
            :..|.|  ..||::..:||.:
  Fly   194 MRALLE--VTQMSQMRLEVAV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psma2aNP_001019612.1 PRK03996 5..233 CDD:235192 76/212 (36%)
proteasome_alpha_type_2 6..231 CDD:239719 76/211 (36%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 76/211 (36%)
proteasome_alpha_type_7 5..213 CDD:239724 76/211 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.