DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf130 and APE3

DIOPT Version :9

Sequence 1:XP_009289393.1 Gene:rnf130 / 553950 ZFINID:ZDB-GENE-050522-525 Length:428 Species:Danio rerio
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:50/207 - (24%)
Similarity:88/207 - (42%) Gaps:46/207 - (22%)


- Green bases have known domain annotations that are detailed below.


Zfish    30 SIGADKTMV-------NKEDYYSAIVNATVLDHKGNPQQMVTKN--DGRYGQNSPKTEAKGIVVA 85
            |.|.:|||.       :.:|||    :.::.:.:....::::.|  |...|::...|.|  ..::
Yeast   111 SKGHNKTMEYILNVFDDMQDYY----DVSLQEFEALSGKIISFNLSDAETGKSFANTTA--FALS 169

Zfish    86 PAA---VNGAVDLQGC-CPHTRF--IVPPK-TTHWVAIMQRGKCTFKEKILKAAAFNASAVIIYN 143
            |..   |...|::... |....:  :|||: ....:|:::||||.|.:|...|..|..:||:||:
Yeast   170 PPVDGFVGKLVEIPNLGCEEKDYASVVPPRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYD 234

Zfish   144 N--NTKEDTVTMAHEGTGDIVA-VMITESFGKEIL----------------GFLE--KNQTVLVS 187
            |  .:||.......|.|...|| |.:....||:::                .::|  |.|.::..
Yeast   235 NEPKSKEGLHGTLGEPTKHTVATVGVPYKVGKKLIANIALNIDYSLYFAMDSYVEFIKTQNIIAD 299

Zfish   188 VIVGSRGMPKNI 199
            .   ..|.|.||
Yeast   300 T---KHGDPDNI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf130XP_009289393.1 PA_GRAIL_like 49..188 CDD:239037 38/168 (23%)
zf-RING_2 271..314 CDD:290367
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 50/207 (24%)
PA_ScAPY_like 155..284 CDD:239045 33/130 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.