DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf130 and H10E21.5

DIOPT Version :9

Sequence 1:XP_009289393.1 Gene:rnf130 / 553950 ZFINID:ZDB-GENE-050522-525 Length:428 Species:Danio rerio
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:189 Identity:78/189 - (41%)
Similarity:121/189 - (64%) Gaps:21/189 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish   197 KNINRGSLVFVSISFIVLMIISSAWLIFYFIQKIRDTSARDRSQRRLGDAAKKAISKLTTRTVKR 261
            ::.::.|::|||||||:||:||.|||:||::|:.|...|:||.||||.:||:||::::.|.|:..
 Worm   153 RSFSKTSVLFVSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTITP 217

Zfish   262 G-DKETEPDFNHCAVCIEGYQLNDVVRILPCKHVFHKMCVDPWLNEHCTCPMCKLNILKALGVMP 325
            | .:|.:.|   ||||::.|||.||:|:|||||::||.|:||||.||.||||||.:|||..|.. 
 Worm   218 GMTQELQSD---CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGYW- 278

Zfish   326 NLPCVDNMAFDMDRMSRSQTSSQRTALVDLSSETSISLEPLRHSSSSQLPSDEELIPRS 384
                 :::..|:...:.|:         .::.:.:|.||  ......|.||.:.:.|.:
 Worm   279 -----NDIRNDIQMPTNSR---------GIADDFTIRLE--LGEQEHQAPSADVISPEA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf130XP_009289393.1 PA_GRAIL_like 49..188 CDD:239037
zf-RING_2 271..314 CDD:290367 28/42 (67%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 78/189 (41%)
RING-H2_GRAIL 226..273 CDD:319582 32/49 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5903
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm12529
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.