DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STYK1 and btl

DIOPT Version :9

Sequence 1:NP_060893.2 Gene:STYK1 / 55359 HGNCID:18889 Length:422 Species:Homo sapiens
Sequence 2:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster


Alignment Length:387 Identity:104/387 - (26%)
Similarity:174/387 - (44%) Gaps:71/387 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    49 IREQRTQQQRSGPQGIAPVPP------PRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQ 107
            |.:|||....:|..|..|...      |.|.:||                               
  Fly   673 IEKQRTTVSTTGTGGTDPAQGFNEYEFPLDSNWE------------------------------- 706

Human   108 VPREQLS--EVLEQICSGSCGPIFRANMNTGDPSKPK----SVILKALKEPAGLHEVQDFLGRIQ 166
            :||:|||  .:|.:   |:.|.:..|... |.|..|:    .|.:|.:||.....::...:..::
  Fly   707 IPRQQLSLGSILGE---GAFGRVVMAEAE-GLPRSPQLAETIVAVKMVKEEHTDTDMASLVREME 767

Human   167 FHQYLGKHKNLVQLEGCCTEKLPLYMVLEDVAQGDLLSFLWTCRRDV----MTMDGLLYD----- 222
            ..:.:|||.|::.|.|||::..||::::|....|:|..||...|...    ...||.|.|     
  Fly   768 VMKMIGKHINIINLLGCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLIS 832

Human   223 ---LTEKQVYHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEV----YTRG 280
               |.||::.....|:...:|:|..:...|.|:||||:|:......|:...|||.::    |.|.
  Fly   833 TQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRK 897

Human   281 AISSTQTIPLKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEV-PPTSILEHLQRRKI 344
              ::...:|:||:|||.|..:....::||||:|:||:|::|.|..|||.: ....:..:|...:.
  Fly   898 --NTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQR 960

Human   345 MKRPSSCTHTMYSIMKSCWRWREADRPSPRELRLRLEAAIKTA-----DDEAVLQVPELVVP 401
            |::|:.|:..:|.:|:.||.:....||:..||....:..::.|     |....|.:|.|..|
  Fly   961 MEKPAKCSLNIYVVMRQCWHFESCARPTFAELVESFDGILQQASSNPNDAYLDLSMPMLETP 1022

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STYK1NP_060893.2 Pkinase_Tyr 117..380 CDD:285015 82/283 (29%)
PKc_like 118..381 CDD:304357 81/283 (29%)
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 91/336 (27%)
TyrKc 712..996 CDD:197581 84/289 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.