DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STYK1 and F09A5.2

DIOPT Version :9

Sequence 1:NP_060893.2 Gene:STYK1 / 55359 HGNCID:18889 Length:422 Species:Homo sapiens
Sequence 2:NP_001360730.1 Gene:F09A5.2 / 181440 WormBaseID:WBGene00008599 Length:867 Species:Caenorhabditis elegans


Alignment Length:258 Identity:87/258 - (33%)
Similarity:133/258 - (51%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   150 KEPAGLHEVQ--DFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYMVLEDVAQGDLLSFLWTCRRD 212
            |.||...|..  ||...|.|.:.||.|.:::.:.||.:......:|:|..|:||||.||   ||.
 Worm   517 KLPAHADEQNHLDFFHEIDFMKRLGHHPHVISMLGCVSNPYEPLIVVEYCARGDLLKFL---RRH 578

Human   213 VMTMDGLLYDLTE------------KQVYHIGKQVLLALEFLQEKHLFHGDVAARNILMQSDLTA 265
               .|.:|.:.|:            |.:..|..||...:.:|..|:..|.|:||||||:...|||
 Worm   579 ---KDYVLMNKTDDCPIEADMCLRIKDLVSIAWQVADGMSYLASKNFIHRDLAARNILLTKSLTA 640

Human   266 KLCGLGLAYEVYTRGAISSTQ--TIPLKWLAPERLLLRPASIRADVWSFGILLYEMVTLGAPPYP 328
            |:...||..  |...|:.:.:  .:|:||::.|.|.|...|.:.||||||:||:|:.::|..|||
 Worm   641 KVSDFGLCR--YMDSALYTAKGGRLPIKWMSVEALKLYEFSTKTDVWSFGVLLFEIFSMGDVPYP 703

Human   329 EVPPTSILEHLQRRKIMKRPSSCTHTMYSIMKSCWRWREADRPSPRELRLRLEAAIKTADDEA 391
            .:....:||||.....:.:|..|.:.:::||:.||..:..|||...|:|..:...: ..|||:
 Worm   704 TIQQVDMLEHLLAGGRLSQPLKCPNEIFNIMQKCWAEKPEDRPEFNEMRGEITVML-NLDDES 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STYK1NP_060893.2 Pkinase_Tyr 117..380 CDD:285015 84/245 (34%)
PKc_like 118..381 CDD:304357 84/246 (34%)
F09A5.2NP_001360730.1 PTKc 473..752 CDD:270623 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.