DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STYK1 and hir-1

DIOPT Version :9

Sequence 1:NP_060893.2 Gene:STYK1 / 55359 HGNCID:18889 Length:422 Species:Homo sapiens
Sequence 2:NP_504458.1 Gene:hir-1 / 178936 WormBaseID:WBGene00016059 Length:903 Species:Caenorhabditis elegans


Alignment Length:412 Identity:108/412 - (26%)
Similarity:184/412 - (44%) Gaps:86/412 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    27 IIVPTLLVTIFLILLGVILWLFIREQ------RTQQQRSGPQGI-----APVPPPRDLSWEAGHG 80
            |::.:|:|.:..|   |::|.:.|::      :.|.::.|...:     .|:...::..||    
 Worm   478 IVIGSLVVILVAI---VVIWFYFRKKSENMKFKFQMEQVGKNNMNRYIDFPIMAAKNDIWE---- 535

Human    81 GNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIF--------RANMNTGD 137
                       :|.               |..:....:::.||:.|.::        .|:.:...
 Worm   536 -----------IER---------------RNLIIHNDKKLGSGAFGAVYLGKLIGKSLAHKDANS 574

Human   138 P-------SKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYMVLE 195
            |       ::...|.:|.|.|.|......:||..|...:.||.|:.||.:..|.||..||.:|:|
 Worm   575 PLGINLMRAENCQVAVKMLPEYADEMSKHEFLREIALMKTLGYHERLVNMLACVTESEPLCLVVE 639

Human   196 DVAQGDLLSFLWTCRRDVMTMDGL-----------LYD----LTEKQVYHIGKQVLLALEFLQEK 245
            ....||||.||....:.:|.:|.|           .||    :|.||:.....|:...||:|.:|
 Worm   640 YCDNGDLLKFLRERCKYMMKLDDLGINYHDPPENENYDTNMIVTLKQLLQFAVQISYGLEYLSQK 704

Human   246 HLFHGDVAARNILMQSDLTAKLCGLGLAYEVY-------TRGAISSTQTIPLKWLAPERLLLRPA 303
            ...|.||||||:|:......|:...||...:|       ::|.     .:||||::||.:.....
 Worm   705 GFVHRDVAARNVLVHEGTACKIGDFGLCRYIYADQSQYKSKGG-----KLPLKWMSPEAIRHYEF 764

Human   304 SIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSSCTHTMYSIMKSCWRWREA 368
            ||::|:|||||||:|::|||..|||.:||..:|..|:....:::|.:|....|.:|..||.....
 Worm   765 SIKSDIWSFGILLFEVITLGGSPYPGMPPEDVLPFLEGGGRIEKPDNCPENFYDVMMQCWNADPD 829

Human   369 DRPSPRELRLRLEAAIKTADDE 390
            ||....::|::|...::...::
 Worm   830 DRIEFSDVRMQLATQLEDITED 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STYK1NP_060893.2 Pkinase_Tyr 117..380 CDD:285015 93/299 (31%)
PKc_like 118..381 CDD:304357 93/299 (31%)
hir-1NP_504458.1 fn3 85..163 CDD:365830
PTKc 547..842 CDD:270623 93/299 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4430
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.