DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hmg20b and Dsp1

DIOPT Version :9

Sequence 1:NP_001018387.1 Gene:hmg20b / 553572 ZFINID:ZDB-GENE-030131-4258 Length:301 Species:Danio rerio
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:123 Identity:44/123 - (35%)
Similarity:66/123 - (53%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


Zfish    13 ASKDSQQTDSPQEENQSTSQPVKKRGWPKGKKRKKVL-PNGPKAPVTGYVRFLNERREHIRALHP 76
            |.||.|:    .|.......|.|.....:|||||::. ||.||..::.:..|.|:.|..::||:|
  Fly   238 AEKDKQR----YEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNP 298

Zfish    77 DLPFPEITKRLGAEWSRLAPHDKQRYLDEAERDKMQYARELREYQKSEAYQITCAKVQ 134
            :....:|.|.||.:||.:.|..||:|...|||||.:|.||:.||:.|....::...:|
  Fly   299 EFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hmg20bNP_001018387.1 HMGB-UBF_HMG-box 53..118 CDD:238686 26/64 (41%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 5/17 (29%)
HMGB-UBF_HMG-box 275..339 CDD:238686 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.