DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment habp2 and flz

DIOPT Version :9

Sequence 1:NP_001103843.2 Gene:habp2 / 553472 ZFINID:ZDB-GENE-030131-4721 Length:546 Species:Danio rerio
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:280 Identity:95/280 - (33%)
Similarity:136/280 - (48%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


Zfish   281 TTPT-KLEF----SDCGKAAFSMIAP-----RIFGGRKSLPEAHPWQASFQVRPKGSNATFEHN- 334
            |.|| .|.|    ::||      :.|     ||.||:.|...|:|||.  .||.......|..| 
  Fly  1423 TLPTPNLAFHSPSTECG------VRPHVKSGRIVGGKGSTFGAYPWQV--LVRESTWLGLFTKNK 1479

Zfish   335 CGGTLIDSCWILTAAHCIDE--NDEVRVELGGVNLEKDDPDKQFV--EVEKIIVHENY-TETFDA 394
            |||.||.|.:::|||||...  ...|.| :|..::..|...|:.|  .|:::|||..| ..||: 
  Fly  1480 CGGVLITSRYVITAAHCQPGFLASLVAV-MGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFE- 1542

Zfish   395 LYNDIALLKLKGRNGRCANESRSVRAACLPTDLFP-EGTRCTISGYGATEKHHGVSTQLLDAKVL 458
              ||:|||:|...    ......:...|:|.|:.. .|...|::|:|..:...||.:.|.:.:|.
  Fly  1543 --NDLALLELDSP----VQFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVP 1601

Zfish   459 LISQSRCMS---RNVYGNRMDDSMMCAGYMQGKIDSCQGDSGGPLVCKK-DNIHYIYGVVSWGDS 519
            :|..|.|..   ...:..::..|.:||||..|:.|||:||||||||.:: |..:.:.|.||.|..
  Fly  1602 IIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIK 1666

Zfish   520 CGKKNKPGVYARVTKFIDWI 539
            |.....||||.|.|.:..|:
  Fly  1667 CAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
habp2NP_001103843.2 EGF_CA 80..112 CDD:238011
EGF_CA 158..190 CDD:238011
KR 195..273 CDD:214527
Tryp_SPc 302..539 CDD:214473 86/247 (35%)
Tryp_SPc 303..542 CDD:238113 86/248 (35%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 86/248 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.