DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STRBP and Adat1

DIOPT Version :10

Sequence 1:NP_060857.2 Gene:STRBP / 55342 HGNCID:16462 Length:672 Species:Homo sapiens
Sequence 2:NP_609676.1 Gene:Adat1 / 34787 FlyBaseID:FBgn0028658 Length:394 Species:Drosophila melanogaster


Alignment Length:30 Identity:11/30 - (36%)
Similarity:16/30 - (53%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   544 EVEVDGQKFRGAGPNKKVAKASAALAALEK 573
            |:.|:|::   .|..||..|.|.|..|:.|
  Fly   294 EISVNGKR---QGVTKKKMKTSQAALAISK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STRBPNP_060857.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..73
DZF 81..334 CDD:128842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..371
DSRM_STRBP_rpt1 384..467 CDD:380738
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..499
DSRM_STRBP_rpt2 512..575 CDD:380740 11/30 (37%)
Adat1NP_609676.1 ADEAMc 7..389 CDD:214718 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.