DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIRREL1 and DIP-delta

DIOPT Version :9

Sequence 1:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:489 Identity:107/489 - (21%)
Similarity:173/489 - (35%) Gaps:99/489 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    20 QTRFSQEPADQTVVAGQRAVLPCVLLNYSGI-VQW---TKDGLALGMGQGLKAWPRYRVVGSADA 80
            :.||:|...:.||..|:.|.||||:.:..|. |.|   .:..:.......:...|||.:..:.:.
  Fly    43 EPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT 107

Human    81 GQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTRIDGGP-VILLQAGTPHNLTCR 144
              :.|.:..|...|...|.||.....:.|:...|.|::||....|:..| .:.::.....|:|||
  Fly   108 --WLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCR 170

Human   145 AFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGR----VFTCRSMNE 205
            | :..||..|||.|:..:        |:..:.|::..|....:.|. ..:.|    .:.|.:.| 
  Fly   171 A-DGFPAPKIIWRREDGE--------EIAVEKKKKVLVYDADVLPL-TKVSRNEMGAYLCIATN- 224

Human   206 AIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLI------ 264
            .:|......|.|||...|.:.:..:......|..|...|...|:|:.:.| |.....::      
  Fly   225 GVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIY-WVYNSVMVLPSKKY 288

Human   265 -EDAHESRYET-------NVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDI 321
             .|..|:.|..       |:.|..|.. ..|...|.:|.|..|.        |:...|.|:|   
  Fly   289 KTDYTENSYRAHMKLTIRNLQYGDFGN-YRCISKNSLGETEGSI--------RVYEIPLPST--- 341

Human   322 GSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQV---LSNSNQLLLKSVTQADAG 383
                         |...:|.|..:|......|.|..:...|.|.   .:..|.|...|.:.:.:|
  Fly   342 -------------PSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSG 393

Human   384 TYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGD-----GGKVECFIGSTP-----PPD 438
            ..:..|                :....:.:.|:...|.|:     |.|....||.:.     ||:
  Fly   394 GSSSAA----------------SSSSSMQTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTERPPN 442

Human   439 RIAWAWKENFLEVGTLERYTVERTNSGSGVLSTL 472
            ..|.:.....|    |.|..:    .|||:..||
  Fly   443 EYAASSVAGLL----LHRALL----FGSGIYLTL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 25/97 (26%)
Ig 25..116 CDD:299845 23/94 (24%)
Ig2_KIRREL3-like 138..219 CDD:143236 21/84 (25%)
I-set 223..304 CDD:254352 19/94 (20%)
Ig_2 227..305 CDD:290606 18/91 (20%)
Ig_2 311..405 CDD:290606 16/96 (17%)
IG_like 314..405 CDD:214653 16/93 (17%)
Ig5_KIRREL3 407..504 CDD:143306 18/76 (24%)
IG_like 416..504 CDD:214653 17/67 (25%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 23/93 (25%)
Ig 145..238 CDD:416386 24/103 (23%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 5/7 (71%)
Ig strand C 178..183 CDD:409353 3/4 (75%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/6 (17%)
Ig strand F 216..223 CDD:409353 1/6 (17%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 19/100 (19%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/5 (40%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 1/8 (13%)
Ig strand G 325..334 CDD:409353 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.