DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIRREL1 and rst

DIOPT Version :9

Sequence 1:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:718 Identity:198/718 - (27%)
Similarity:303/718 - (42%) Gaps:137/718 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     2 LSLLVWILTL--SDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQ 64
            |.||..|:.:  |..::.....||:.||.|||.|.|.|..|||.::|..|.:|||||...||..:
  Fly     7 LLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGLGTSR 71

Human    65 GLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQAT-----EAALRSRRAKLTVLIPPEDTR 124
            .|..:.||.:|||.:.|.|:|:|....|.|||.|:||.:     :.|:||..|.||||:|||..:
  Fly    72 DLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPK 136

Human   125 IDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTEL------LKDGKRETTVS 183
            |..|.||.........:.|.:...||||.|.|. ||.   |.|.:..:      |.|.:|.|..|
  Fly   137 ITQGDVIYATEDRKVEIECVSVGGKPAAEITWI-DGL---GNVLTDNIEYTVIPLPDQRRFTAKS 197

Human   184 QLLINPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQT--------------- 233
            .|.:.|........|:|::.|.|..:.:...|.::|.:.|.|.:::....               
  Fly   198 VLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGS 262

Human   234 --VQEGERVV------FTCQATANPEILGYRWAKGGFLIEDAHESRYET-----NVDYSFFTEPV 285
              :..|.|:|      ..|:|.|||..:.|||    |:.::......:|     ||...|....|
  Fly   263 VHMSTGSRIVEHSQVRLECRADANPSDVRYRW----FINDEPIIGGQKTEMVIRNVTRKFHDAIV 323

Human   286 SCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGP 350
            .|||.|.||.:..|..:::.:||.....|:....|:||.|:|||....||...:.|.:..|:   
  Fly   324 KCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSD--- 385

Human   351 RPPGSPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEA 415
                         :|:..|..|.. ||:...||.|.|:|.||.......:..:|:.|.|.|.|:.
  Fly   386 -------------RVVGTSTNLTF-SVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQR 436

Human   416 VQYAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEA 480
            .||.:.||..::|||..|.|....::|.:....:...:...|::.......||.|||.|.: .:|
  Fly   437 TQYGLVGDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRD-SQA 500

Human   481 DFQTHYNCTAWNSFGPGTAIIQLEERE--VLPVGIIAGATIGASILLIFFFIALVFFLYRRRKGS 543
            .....||||..|.:|...|.|||:.::  .|.:.|:.|.::.|.:|::...:.:.....:|.|..
  Fly   501 YHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLP 565

Human   544 RKDVTLRKLDIKVETVNREPLTMHS------DREDDTASVSTATRVMKAIYSSFKDDVDLKQDLR 602
            ..||           ::...:|.:.      :..|.|::.|                 |||.|: 
  Fly   566 PADV-----------ISEHQITKNGGVSCKLEPGDRTSNYS-----------------DLKVDI- 601

Human   603 CDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYR---APGPARFDGRPSSRLSHSSGYA 664
                           :.||              |.|.||.   :| |.::....|::.:.||...
  Fly   602 ---------------SGGY--------------VPYGDYSTHYSP-PPQYLTTCSTKSNGSSTIM 636

Human   665 QLN 667
            |.|
  Fly   637 QNN 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 44/98 (45%)
Ig 25..116 CDD:299845 42/95 (44%)
Ig2_KIRREL3-like 138..219 CDD:143236 23/86 (27%)
I-set 223..304 CDD:254352 26/108 (24%)
Ig_2 227..305 CDD:290606 24/105 (23%)
Ig_2 311..405 CDD:290606 24/93 (26%)
IG_like 314..405 CDD:214653 24/90 (27%)
Ig5_KIRREL3 407..504 CDD:143306 31/96 (32%)
IG_like 416..504 CDD:214653 27/87 (31%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 43/95 (45%)
Ig 42..114 CDD:299845 31/71 (44%)
C2-set_2 135..225 CDD:285423 26/93 (28%)
Ig_3 265..329 CDD:290638 20/67 (30%)
I-set 346..420 CDD:254352 25/90 (28%)
Ig 360..425 CDD:299845 22/81 (27%)
Ig5_KIRREL3-like 428..524 CDD:143235 31/96 (32%)
IG_like 435..524 CDD:214653 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148511
Domainoid 1 1.000 87 1.000 Domainoid score I7984
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10089
Inparanoid 1 1.050 259 1.000 Inparanoid score I3128
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 1 1.000 - - FOG0001084
OrthoInspector 1 1.000 - - mtm8470
orthoMCL 1 0.900 - - OOG6_103358
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1593
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.660

Return to query results.
Submit another query.