DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIRREL1 and Kirrel1

DIOPT Version :10

Sequence 1:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:756 Identity:729/756 - (96%)
Similarity:739/756 - (97%) Gaps:0/756 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    18 GTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQ 82
            ||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||
  Rat    50 GTQTRFSQEPADQTVVAGHRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQ 114

Human    83 YNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHNLTCRAFN 147
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||
  Rat   115 YNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPYNLTCRAFN 179

Human   148 AKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEAIPSGKE 212
            ||||||||||||||||||||.|||||||||||||:|||||.||||||||||||||||||||:|||
  Rat   180 AKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIQPTDLDIGRVFTCRSMNEAIPNGKE 244

Human   213 TSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVD 277
            ||||||||||||||||||||||.|||||:||||||||||||||||||||||||||||||||||||
  Rat   245 TSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVD 309

Human   278 YSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWT 342
            ||||||||||||:||||||||||||||||||||||.|||||||||||||||||||||||||||||
  Rat   310 YSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPPLTLTWT 374

Human   343 KKDSNMGPRPPGSPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNG 407
            |||||||||.|||||||.|||||||||||||||||||||||||||||||||||||||||||||||
  Rat   375 KKDSNMGPRLPGSPPEANLSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNG 439

Human   408 PPIISSEAVQYAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTL 472
            ||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   440 PPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTL 504

Human   473 TINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGATIGASILLIFFFIALVFFLY 537
            |||||||||||||||||||||||||||||||||||||||||||||||||.|||:|.|.|||||||
  Rat   505 TINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGATIGAGILLVFSFAALVFFLY 569

Human   538 RRRKGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTASVSTATRVMKAIYSSFKDDVDLKQDLR 602
            |||||||||||||||||||||||||||||||||||||.|:||||||||||||||||||||||||.
  Rat   570 RRRKGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTTSISTATRVMKAIYSSFKDDVDLKQDLH 634

Human   603 CDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQLN 667
            ||||:|||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||
  Rat   635 CDTIETREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPTRFDGRPSSRLSHSSGYAQLN 699

Human   668 TYSRGPASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLGYPQAPPSGL 732
            ||||.||||||.||||.||:||.||||||||||||||||||||||||||||||||||||||||||
  Rat   700 TYSRAPASDYGTEPTPSGPSAPGGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLGYPQAPPSGL 764

Human   733 ERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV 773
            |||||||||||||||||||||||||||||||||||||||||
  Rat   765 ERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KIRREL1XP_005245362.1 Ig 22..116 CDD:472250 92/93 (99%)
Ig strand B 38..42 CDD:409353 3/3 (100%)
Ig strand C 51..54 CDD:409353 2/2 (100%)
Ig strand E 78..87 CDD:409353 8/8 (100%)
Ig strand F 97..102 CDD:409353 4/4 (100%)
Ig strand G 109..112 CDD:409353 2/2 (100%)
IgI_2_KIRREL3-like 122..219 CDD:409416 91/96 (95%)
Ig strand A 123..126 CDD:409416 2/2 (100%)
Ig strand A' 129..133 CDD:409416 3/3 (100%)
Ig strand B 140..147 CDD:409416 6/6 (100%)
Ig strand C 152..157 CDD:409416 4/4 (100%)
Ig strand C' 160..162 CDD:409416 1/1 (100%)
Ig strand D 165..172 CDD:409416 5/6 (83%)
Ig strand E 179..187 CDD:409416 6/7 (86%)
Ig strand F 196..204 CDD:409416 7/7 (100%)
Ig strand G 210..216 CDD:409416 5/5 (100%)
Ig_3 222..291 CDD:464046 66/68 (97%)
Ig_3 308..389 CDD:464046 77/80 (96%)
IgI_5_KIRREL3 407..504 CDD:409479 95/96 (99%)
Ig strand A 408..412 CDD:409479 3/3 (100%)
Ig strand A' 414..417 CDD:409479 2/2 (100%)
Ig strand B 425..432 CDD:409479 6/6 (100%)
Ig strand C 439..444 CDD:409479 4/4 (100%)
Ig strand C' 446..449 CDD:409479 2/2 (100%)
Ig strand D 457..464 CDD:409479 6/6 (100%)
Ig strand E 467..474 CDD:409479 6/6 (100%)
Ig strand F 485..492 CDD:409479 6/6 (100%)
Ig strand G 495..502 CDD:409479 6/6 (100%)
Kirrel1XP_006232737.1 Ig 54..148 CDD:472250 92/93 (99%)
Ig strand B 70..74 CDD:409389 3/3 (100%)
Ig strand C 83..86 CDD:409389 2/2 (100%)
Ig strand E 110..119 CDD:409389 8/8 (100%)
Ig strand F 129..134 CDD:409389 4/4 (100%)
Ig strand G 141..144 CDD:409389 2/2 (100%)
IgI_2_KIRREL3-like 154..251 CDD:409416 91/96 (95%)
Ig strand A 155..158 CDD:409416 2/2 (100%)
Ig strand A' 161..165 CDD:409416 3/3 (100%)
Ig strand B 172..179 CDD:409416 6/6 (100%)
Ig strand C 184..189 CDD:409416 4/4 (100%)
Ig strand C' 192..194 CDD:409416 1/1 (100%)
Ig strand D 197..204 CDD:409416 5/6 (83%)
Ig strand E 211..219 CDD:409416 6/7 (86%)
Ig strand F 228..236 CDD:409416 7/7 (100%)
Ig strand G 242..248 CDD:409416 5/5 (100%)
Ig_3 254..>314 CDD:464046 57/59 (97%)
Ig_3 340..421 CDD:464046 77/80 (96%)
IgI_5_KIRREL3 439..536 CDD:409479 95/96 (99%)
Ig strand A 440..444 CDD:409479 3/3 (100%)
Ig strand A' 446..449 CDD:409479 2/2 (100%)
Ig strand B 457..464 CDD:409479 6/6 (100%)
Ig strand C 471..476 CDD:409479 4/4 (100%)
Ig strand C' 478..481 CDD:409479 2/2 (100%)
Ig strand D 489..496 CDD:409479 6/6 (100%)
Ig strand E 499..506 CDD:409479 6/6 (100%)
Ig strand F 517..524 CDD:409479 6/6 (100%)
Ig strand G 527..534 CDD:409479 6/6 (100%)

Return to query results.
Submit another query.