DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRMT6 and Art2

DIOPT Version :10

Sequence 1:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens
Sequence 2:NP_608821.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:18/53 - (33%) Gaps:14/53 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   276 IPGGTVVLVPPVLSKEEDGGDKVEDGEGDGDEDLPTQTEAPTPTPAPAWPAPP 328
            :||.||...||..::.....              ||...:|..|..|..|.||
  Fly    23 VPGSTVFRFPPATNEPCTAS--------------PTAYHSPVDTGDPNVPPPP 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
COG4076 51..>223 CDD:443253
Art2NP_608821.1 COG4076 39..>204 CDD:443253 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.