DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS18A and mRpS18C

DIOPT Version :10

Sequence 1:XP_006715197.1 Gene:MRPS18A / 55168 HGNCID:14515 Length:270 Species:Homo sapiens
Sequence 2:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster


Alignment Length:82 Identity:25/82 - (30%)
Similarity:43/82 - (52%) Gaps:14/82 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    54 TATPKES----------PNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGML-PRKITGL 107
            :|.|:.|          |...:|. ||.:|:.:::.  :|.:|.|||||..|:.|.: .|.||||
  Fly    31 SAAPESSDLDLPIDIKNPYEKDPQ-QCILCKHSIEP--HYKNVKLLSQFQSPYTGRIYGRHITGL 92

Human   108 CQEEHRKIEECVKMAHR 124
            |:....::|:.:..|.:
  Fly    93 CKRRQEQVEQAILRAQQ 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS18AXP_006715197.1 Ribosomal_S18 78..126 CDD:460054 17/48 (35%)
mRpS18CNP_524593.1 Ribosomal_S18 63..113 CDD:460054 17/49 (35%)

Return to query results.
Submit another query.