DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM28 and tra2

DIOPT Version :10

Sequence 1:NP_060547.2 Gene:RBM28 / 55131 HGNCID:21863 Length:759 Species:Homo sapiens
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:112 Identity:25/112 - (22%)
Similarity:39/112 - (34%) Gaps:39/112 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   115 EDNWSGMVLAQVPFLQDYFYIS----------YKKDPVLYVYQLLDDYKEGNLHIIPE-----TP 164
            :|..|.....|.||:.|:|.:|          :|:...|.           |....|.     .|
  Fly    89 QDVLSSPDCVQKPFMYDFFRLSKGLFGAPADQWKRHRKLL-----------NASFSPAALKSFVP 142

Human   165 LAEARSGDDNDFLIGSWVQYTRDDGSKKFGKV--VYKVLANPTVYFI 209
            ...|::.           |:||:...|..|:.  |:|:||..|:..|
  Fly   143 TLNAKAD-----------QFTRELAGKVSGECFDVHKLLARYTLVTI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM28NP_060547.2 RRM1_RBM28_like 5..81 CDD:409847
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..105
RRM2_RBM28_like 115..190 CDD:409848 17/89 (19%)
PABP-1234 126..721 CDD:130689 22/101 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..330 4/9 (44%)
RRM3_RBM28_like 335..417 CDD:409849
RRM4_RBM28_like 487..581 CDD:409850
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..759
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 21/100 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.