DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM28 and Rsf1

DIOPT Version :10

Sequence 1:NP_060547.2 Gene:RBM28 / 55131 HGNCID:21863 Length:759 Species:Homo sapiens
Sequence 2:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster


Alignment Length:82 Identity:25/82 - (30%)
Similarity:45/82 - (54%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   107 AKVADKK-ARLIIRNLSFKCSEDDLKTVFAQFGAVLEVNIPRKPDGKMRGFGFVQFKNLLEAGKA 170
            :.:.|:: .|:.:.||:.|..:|||:..|.::|.:..|.|...|.    ||.||:|::..:|.||
  Fly     2 SSMGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFNPP----GFAFVEFEHRDDAEKA 62

Human   171 LKGMNMKEIKGRTVAVD 187
            ...:|..|:.|..:.|:
  Fly    63 CDILNGSELLGSQLRVE 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM28NP_060547.2 RRM1_RBM28_like 5..81 CDD:409847
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..105
RRM2_RBM28_like 115..190 CDD:409848 24/73 (33%)
PABP-1234 126..721 CDD:130689 20/62 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..330
RRM3_RBM28_like 335..417 CDD:409849
RRM4_RBM28_like 487..581 CDD:409850
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..759
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 24/73 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.