DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AKIRIN2 and CG42830

DIOPT Version :10

Sequence 1:NP_060534.1 Gene:AKIRIN2 / 55122 HGNCID:21407 Length:203 Species:Homo sapiens
Sequence 2:NP_001188834.1 Gene:CG42830 / 10178909 FlyBaseID:FBgn0262017 Length:187 Species:Drosophila melanogaster


Alignment Length:106 Identity:37/106 - (34%)
Similarity:58/106 - (54%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    98 LETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEK 162
            |::.|..::. |...::.|.      |.|.|        :..:.|||.:|:.::|..::|:.|::
  Fly    98 LDSDFSDSEE-CRPKSEIHV------AKPET--------EDNRDLFTYQQLKLMCCEMMKQCEDR 147

Human   163 VREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS 203
            |..|||..|..|:|||||.|:||.|||:.|.. |..|||:|
  Fly   148 VVLEYEIALTQKMAEQYDTFIKFNHDQLQREC-EHRASYLS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AKIRIN2NP_060534.1 akirin-2 2..203 CDD:412036 36/104 (35%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:18066067 22..27
SYVS motif. /evidence=ECO:0000305|PubMed:34711951 200..203 2/2 (100%)
CG42830NP_001188834.1 akirin <127..187 CDD:425410 29/60 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.