| Sequence 1: | NP_002703.1 | Gene: | PPP1R7 / 5510 | HGNCID: | 9295 | Length: | 360 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
| Alignment Length: | 241 | Identity: | 56/241 - (23%) |
|---|---|---|---|
| Similarity: | 104/241 - (43%) | Gaps: | 40/241 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Human 10 QQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELP--VDMETI 72
Human 73 NLDRDAEDVDLNHY--RIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ----SLRELDLYDNQ 131
Human 132 IKKIENL-EALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGS 195
Human 196 NRIRAIENIDTL---TNLESLFLGKNKITKLQNLDALTNLTVLSMQ 238 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PPP1R7 | NP_002703.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..64 | 12/53 (23%) | |
| LRR 1 | 77..98 | 3/22 (14%) | |||
| internalin_A | 87..>317 | CDD:380193 | 39/160 (24%) | ||
| LRR 2 | 99..120 | 4/20 (20%) | |||
| leucine-rich repeat | 100..121 | CDD:275380 | 5/24 (21%) | ||
| LRR 3 | 121..142 | 5/21 (24%) | |||
| leucine-rich repeat | 122..143 | CDD:275380 | 6/21 (29%) | ||
| LRR 4 | 143..164 | 7/20 (35%) | |||
| leucine-rich repeat | 144..165 | CDD:275380 | 8/20 (40%) | ||
| LRR 5 | 165..186 | 4/20 (20%) | |||
| leucine-rich repeat | 166..187 | CDD:275380 | 5/20 (25%) | ||
| LRR 6 | 187..208 | 6/23 (26%) | |||
| leucine-rich repeat | 188..209 | CDD:275380 | 6/23 (26%) | ||
| LRR 7 | 209..230 | 4/20 (20%) | |||
| leucine-rich repeat | 210..231 | CDD:275380 | 5/20 (25%) | ||
| LRR 8 | 231..252 | 2/8 (25%) | |||
| leucine-rich repeat | 232..253 | CDD:275380 | 2/7 (29%) | ||
| LRR 9 | 253..274 | ||||
| leucine-rich repeat | 254..275 | CDD:275380 | |||
| LRR 10 | 275..296 | ||||
| leucine-rich repeat | 276..297 | CDD:275380 | |||
| LRR 11 | 297..318 | ||||
| LRRcap | 336..354 | CDD:197729 | |||
| CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 16/56 (29%) |
| leucine-rich repeat | 146..168 | CDD:275380 | 6/21 (29%) | ||
| LRR_4 | 168..209 | CDD:289563 | 12/40 (30%) | ||
| leucine-rich repeat | 169..190 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 191..212 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 213..237 | CDD:275380 | 6/23 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||