DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R7 and CG14185

DIOPT Version :10

Sequence 1:NP_002703.1 Gene:PPP1R7 / 5510 HGNCID:9295 Length:360 Species:Homo sapiens
Sequence 2:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster


Alignment Length:241 Identity:56/241 - (23%)
Similarity:104/241 - (43%) Gaps:40/241 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    10 QQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELP--VDMETI 72
            ||.|:.|:.:||        :.|:::|.               :|.....|||..||  |.:..:
  Fly    54 QQQQQRMQFNRR--------QLGRRNSF---------------DRDVAIAEEEQHLPAFVHLLPV 95

Human    73 NLDRDAEDVDLNHY--RIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ----SLRELDLYDNQ 131
            .|.:...:..|:..  |:.:....|.:::|     |..:|....:|..|.    .|:.|||..:.
  Fly    96 VLPQQGPEPTLDELLRRVTQRTDLEAVEQV-----RLRVISYTVSLSRLSLFLPRLQSLDLSGSV 155

Human   132 IKKIENL-EALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGS 195
            :..:.:| ..|.:|..||||...|.:.:|...|..::.|....|.|.:::.|:.|..|::|:..:
  Fly   156 LSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARN 220

Human   196 NRIRAIENIDTL---TNLESLFLGKNKITKLQNLDALTNLTVLSMQ 238
            |||..:..:..|   ..|:.:.|..|.:.:|....:|...:|.::|
  Fly   221 NRISELGLLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R7NP_002703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 12/53 (23%)
LRR 1 77..98 3/22 (14%)
PPP1R42 <83..198 CDD:455733 30/121 (25%)
LRR 2 99..120 4/20 (20%)
leucine-rich repeat 100..121 CDD:275380 5/24 (21%)
LRR 3 121..142 5/21 (24%)
leucine-rich repeat 122..143 CDD:275380 6/21 (29%)
LRR 4 143..164 7/20 (35%)
leucine-rich repeat 144..165 CDD:275380 8/20 (40%)
PPP1R42 163..354 CDD:455733 19/79 (24%)
LRR 5 165..186 4/20 (20%)
leucine-rich repeat 166..187 CDD:275380 5/20 (25%)
LRR 6 187..208 6/23 (26%)
leucine-rich repeat 188..209 CDD:275380 6/23 (26%)
LRR 7 209..230 4/20 (20%)
leucine-rich repeat 210..231 CDD:275380 5/20 (25%)
LRR 8 231..252 2/8 (25%)
leucine-rich repeat 232..253 CDD:275380 2/7 (29%)
LRR 9 253..274
leucine-rich repeat 254..275 CDD:275380
LRR 10 275..296
leucine-rich repeat 276..297 CDD:275380
LRR 11 297..318
CG14185NP_649175.1 leucine-rich repeat 146..168 CDD:275380 6/21 (29%)
PPP1R42 <169..271 CDD:455733 26/98 (27%)
leucine-rich repeat 169..190 CDD:275380 8/20 (40%)
leucine-rich repeat 191..212 CDD:275380 5/20 (25%)
leucine-rich repeat 213..237 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.