DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R7 and CG10839

DIOPT Version :9

Sequence 1:NP_002703.1 Gene:PPP1R7 / 5510 HGNCID:9295 Length:360 Species:Homo sapiens
Sequence 2:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster


Alignment Length:204 Identity:47/204 - (23%)
Similarity:94/204 - (46%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   160 VDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSN-RIRAIENID----TLTNLESLFLGKNK 219
            :.|.|.||      :.::|.|:.:........|:|.. :...||.:|    :||..:.|.|..|.
  Fly     1 MSKPTTLK------DALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNM 59

Human   220 ITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVN-LRELYLSHNGIEVIEGLENNNKLTMLDIAS 283
            |.|:..:..:.||.|||:..|.|..:.|::.|.: |.||::|:|.||..:.||:           
  Fly    60 IEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLES----------- 113

Human   284 NRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKD---PQYRRKVML 345
                       :..|:.|:::.|:::.|::...:....:|..:....|||.::   ..:..:.:.
  Fly   114 -----------MKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVR 167

Human   346 ALPSVRQID 354
            .||:::::|
  Fly   168 RLPNMKKLD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R7NP_002703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
LRR 1 77..98
internalin_A 87..>317 CDD:380193 40/162 (25%)
LRR 2 99..120
leucine-rich repeat 100..121 CDD:275380
LRR 3 121..142
leucine-rich repeat 122..143 CDD:275380
LRR 4 143..164 1/3 (33%)
leucine-rich repeat 144..165 CDD:275380 1/4 (25%)
LRR 5 165..186 4/20 (20%)
leucine-rich repeat 166..187 CDD:275380 4/20 (20%)
LRR 6 187..208 5/25 (20%)
leucine-rich repeat 188..209 CDD:275380 6/25 (24%)
LRR 7 209..230 5/20 (25%)
leucine-rich repeat 210..231 CDD:275380 5/20 (25%)
LRR 8 231..252 8/20 (40%)
leucine-rich repeat 232..253 CDD:275380 8/20 (40%)
LRR 9 253..274 9/21 (43%)
leucine-rich repeat 254..275 CDD:275380 9/20 (45%)
LRR 10 275..296 0/20 (0%)
leucine-rich repeat 276..297 CDD:275380 0/20 (0%)
LRR 11 297..318 4/20 (20%)
LRRcap 336..354 CDD:197729 2/20 (10%)
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 31/113 (27%)
LRR_4 48..90 CDD:289563 14/41 (34%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
LRR_8 51..105 CDD:290566 19/53 (36%)
leucine-rich repeat 72..94 CDD:275380 8/21 (38%)
leucine-rich repeat 95..116 CDD:275380 9/42 (21%)
leucine-rich repeat 117..141 CDD:275380 4/23 (17%)
leucine-rich repeat 142..171 CDD:275380 5/28 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.