Sequence 1: | NP_002703.1 | Gene: | PPP1R7 / 5510 | HGNCID: | 9295 | Length: | 360 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246039.1 | Gene: | CG10839 / 34944 | FlyBaseID: | FBgn0028858 | Length: | 182 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 47/204 - (23%) |
---|---|---|---|
Similarity: | 94/204 - (46%) | Gaps: | 37/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Human 160 VDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSN-RIRAIENID----TLTNLESLFLGKNK 219
Human 220 ITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVN-LRELYLSHNGIEVIEGLENNNKLTMLDIAS 283
Human 284 NRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKD---PQYRRKVML 345
Human 346 ALPSVRQID 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PPP1R7 | NP_002703.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..64 | ||
LRR 1 | 77..98 | ||||
internalin_A | 87..>317 | CDD:380193 | 40/162 (25%) | ||
LRR 2 | 99..120 | ||||
leucine-rich repeat | 100..121 | CDD:275380 | |||
LRR 3 | 121..142 | ||||
leucine-rich repeat | 122..143 | CDD:275380 | |||
LRR 4 | 143..164 | 1/3 (33%) | |||
leucine-rich repeat | 144..165 | CDD:275380 | 1/4 (25%) | ||
LRR 5 | 165..186 | 4/20 (20%) | |||
leucine-rich repeat | 166..187 | CDD:275380 | 4/20 (20%) | ||
LRR 6 | 187..208 | 5/25 (20%) | |||
leucine-rich repeat | 188..209 | CDD:275380 | 6/25 (24%) | ||
LRR 7 | 209..230 | 5/20 (25%) | |||
leucine-rich repeat | 210..231 | CDD:275380 | 5/20 (25%) | ||
LRR 8 | 231..252 | 8/20 (40%) | |||
leucine-rich repeat | 232..253 | CDD:275380 | 8/20 (40%) | ||
LRR 9 | 253..274 | 9/21 (43%) | |||
leucine-rich repeat | 254..275 | CDD:275380 | 9/20 (45%) | ||
LRR 10 | 275..296 | 0/20 (0%) | |||
leucine-rich repeat | 276..297 | CDD:275380 | 0/20 (0%) | ||
LRR 11 | 297..318 | 4/20 (20%) | |||
LRRcap | 336..354 | CDD:197729 | 2/20 (10%) | ||
CG10839 | NP_001246039.1 | LRR_RI | <37..129 | CDD:238064 | 31/113 (27%) |
LRR_4 | 48..90 | CDD:289563 | 14/41 (34%) | ||
leucine-rich repeat | 50..71 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 51..105 | CDD:290566 | 19/53 (36%) | ||
leucine-rich repeat | 72..94 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 9/42 (21%) | ||
leucine-rich repeat | 117..141 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 142..171 | CDD:275380 | 5/28 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |