Sequence 1: | NP_002703.1 | Gene: | PPP1R7 / 5510 | HGNCID: | 9295 | Length: | 360 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
Alignment Length: | 254 | Identity: | 70/254 - (27%) |
---|---|---|---|
Similarity: | 114/254 - (44%) | Gaps: | 59/254 - (23%) |
- Green bases have known domain annotations that are detailed below.
Human 55 GEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEEL 119
Human 120 QSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSN 184
Human 185 LHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQ 249
Human 250 NLV--NLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDN 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PPP1R7 | NP_002703.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..64 | 4/8 (50%) | |
LRR 1 | 77..98 | 0/20 (0%) | |||
internalin_A | 87..>317 | CDD:380193 | 63/222 (28%) | ||
LRR 2 | 99..120 | 2/20 (10%) | |||
leucine-rich repeat | 100..121 | CDD:275380 | 1/20 (5%) | ||
LRR 3 | 121..142 | 8/20 (40%) | |||
leucine-rich repeat | 122..143 | CDD:275380 | 7/20 (35%) | ||
LRR 4 | 143..164 | 6/20 (30%) | |||
leucine-rich repeat | 144..165 | CDD:275380 | 7/20 (35%) | ||
LRR 5 | 165..186 | 8/20 (40%) | |||
leucine-rich repeat | 166..187 | CDD:275380 | 8/20 (40%) | ||
LRR 6 | 187..208 | 8/20 (40%) | |||
leucine-rich repeat | 188..209 | CDD:275380 | 8/20 (40%) | ||
LRR 7 | 209..230 | 7/20 (35%) | |||
leucine-rich repeat | 210..231 | CDD:275380 | 7/20 (35%) | ||
LRR 8 | 231..252 | 7/20 (35%) | |||
leucine-rich repeat | 232..253 | CDD:275380 | 6/22 (27%) | ||
LRR 9 | 253..274 | 5/20 (25%) | |||
leucine-rich repeat | 254..275 | CDD:275380 | 5/20 (25%) | ||
LRR 10 | 275..296 | 4/20 (20%) | |||
leucine-rich repeat | 276..297 | CDD:275380 | 5/20 (25%) | ||
LRR 11 | 297..318 | 3/10 (30%) | |||
LRRcap | 336..354 | CDD:197729 | |||
Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | 7/57 (12%) |
leucine-rich repeat | 32..53 | CDD:275380 | 7/20 (35%) | ||
LRR_RI | <49..189 | CDD:238064 | 47/158 (30%) | ||
LRR_4 | 76..115 | CDD:289563 | 15/38 (39%) | ||
leucine-rich repeat | 76..97 | CDD:275380 | 8/20 (40%) | ||
LRR_8 | 97..152 | CDD:290566 | 20/54 (37%) | ||
LRR_4 | 97..137 | CDD:289563 | 15/39 (38%) | ||
leucine-rich repeat | 98..119 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 140..200 | CDD:290566 | 20/79 (25%) | ||
leucine-rich repeat | 142..165 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 166..190 | CDD:275380 | 10/42 (24%) | ||
IQ | 581..599 | CDD:197470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |