DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1R7 and Cep97

DIOPT Version :9

Sequence 1:NP_002703.1 Gene:PPP1R7 / 5510 HGNCID:9295 Length:360 Species:Homo sapiens
Sequence 2:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster


Alignment Length:254 Identity:70/254 - (27%)
Similarity:114/254 - (44%) Gaps:59/254 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    55 GEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEEL 119
            |:|..||:|       .:||.:                  :.||||             ...::.
  Fly     3 GDESGEEKH-------VLNLSK------------------QKLKKV-------------PKQDDA 29

Human   120 QSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSN 184
            .|:|:|.|.:|:::||:|:::..::|.|.::.|.|..:.||.:|..|::|.|..|.|..||.|..
  Fly    30 HSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKE 94

Human   185 LHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQ 249
            ...|::|.|..|.|:.||:::|..|||.|.|..|.|..:.::..|.||..|.:..||||.:....
  Fly    95 CIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCD 159

Human   250 NLV--NLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDN 306
            ..:  :|..|.|:.|.|                   |.:.:|..:|||:.|....:.||
  Fly   160 KCLPTSLETLTLAKNSI-------------------NDLNEICTLSHLSNLLSISIADN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1R7NP_002703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 4/8 (50%)
LRR 1 77..98 0/20 (0%)
internalin_A 87..>317 CDD:380193 63/222 (28%)
LRR 2 99..120 2/20 (10%)
leucine-rich repeat 100..121 CDD:275380 1/20 (5%)
LRR 3 121..142 8/20 (40%)
leucine-rich repeat 122..143 CDD:275380 7/20 (35%)
LRR 4 143..164 6/20 (30%)
leucine-rich repeat 144..165 CDD:275380 7/20 (35%)
LRR 5 165..186 8/20 (40%)
leucine-rich repeat 166..187 CDD:275380 8/20 (40%)
LRR 6 187..208 8/20 (40%)
leucine-rich repeat 188..209 CDD:275380 8/20 (40%)
LRR 7 209..230 7/20 (35%)
leucine-rich repeat 210..231 CDD:275380 7/20 (35%)
LRR 8 231..252 7/20 (35%)
leucine-rich repeat 232..253 CDD:275380 6/22 (27%)
LRR 9 253..274 5/20 (25%)
leucine-rich repeat 254..275 CDD:275380 5/20 (25%)
LRR 10 275..296 4/20 (20%)
leucine-rich repeat 276..297 CDD:275380 5/20 (25%)
LRR 11 297..318 3/10 (30%)
LRRcap 336..354 CDD:197729
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 7/57 (12%)
leucine-rich repeat 32..53 CDD:275380 7/20 (35%)
LRR_RI <49..189 CDD:238064 47/158 (30%)
LRR_4 76..115 CDD:289563 15/38 (39%)
leucine-rich repeat 76..97 CDD:275380 8/20 (40%)
LRR_8 97..152 CDD:290566 20/54 (37%)
LRR_4 97..137 CDD:289563 15/39 (38%)
leucine-rich repeat 98..119 CDD:275380 8/20 (40%)
leucine-rich repeat 120..141 CDD:275380 7/20 (35%)
LRR_8 140..200 CDD:290566 20/79 (25%)
leucine-rich repeat 142..165 CDD:275380 6/22 (27%)
leucine-rich repeat 166..190 CDD:275380 10/42 (24%)
IQ 581..599 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.