DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAPBPL and side-V

DIOPT Version :9

Sequence 1:NP_060479.3 Gene:TAPBPL / 55080 HGNCID:30683 Length:468 Species:Homo sapiens
Sequence 2:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster


Alignment Length:429 Identity:85/429 - (19%)
Similarity:128/429 - (29%) Gaps:174/429 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    10 LLCLALSGAAETKPHPAEGQWRAVDVVLDCF-LAKDGAHRGALASSEDRARASLVL--------K 65
            |.||:..|.    |.|....||...::.|.| :..||:.|..|.....:.:..|.:        .
  Fly   185 LTCLSSGGV----PPPRVSWWREHALIDDSFQVLPDGSVRNVLRLKNIQRKDLLTMYTCQASNGH 245

Human    66 QVPVLDDGSLEDFT------DFQG-------GTL---------AQDDPPIIFEASVDLVQ----- 103
            .||.|....:.|..      ..||       ||.         |:..|.||:..:..:|:     
  Fly   246 VVPALTKKVILDMNLPPLSLLLQGLNHAVIAGTRSHVTCTAIGARPPPEIIWSKAGQIVRGATSS 310

Human   104 --------------IPQAEALLHADCSGKEVTCEIS------RYFLQMTETTVKTAAWFMANMQV 148
                          ||..|.      :.::|.|.||      ...|....|||.|..        
  Fly   311 TSSDGNTTISELMLIPVPED------NERQVVCSISLNAGITSQQLHEGHTTVMTTL-------- 361

Human   149 SGGGPSISLVMKTPRVTKNEALWH-PTLNL----PLSPQGTVRTAVEFQVMTQTQSLSFLLGSSA 208
              |.....|.:|..||..   :.| |.:||    ||.|.                  :.|.|:..
  Fly   362 --GNGHTGLYLKDSRVLN---VTHAPIVNLNLGAPLDPD------------------NLLKGTDV 403

Human   209 SLDCGFSMAPGLDLISVEW----RLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLT 269
            .|:|.....|.  :..|||    :..|..||.::.:.|                         |.
  Fly   404 YLECDVKANPA--ITRVEWYHSDKQLHSSRGIIISNQT-------------------------LV 441

Human   270 LPGLTIQDEGTYICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVT 334
            |.|::....|.|.|:.:            |:|.|..     :||..|     |:.  ||      
  Fly   442 LQGISKSSHGQYFCRAS------------NLQGSVS-----SNEVYL-----DVK--YP------ 476

Human   335 WTREELGGSPAQVSGASFSSLRQSVAGTYSISSSLTAEP 373
                       .|..:..:.:|.::..|.:|:..:.|.|
  Fly   477 -----------PVCKSESTIIRAALKQTINITCEVDANP 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAPBPLNP_060479.3 IG_like 198..300 CDD:214653 18/105 (17%)
Ig 204..300 CDD:299845 17/99 (17%)
IgC_Tapasin_R 266..396 CDD:143248 21/108 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..468
side-VNP_611765.2 Ig 42..153 CDD:299845
IG_like 42..152 CDD:214653
IGc2 179..245 CDD:197706 15/63 (24%)
IG_like 179..245 CDD:214653 15/63 (24%)
Ig <282..348 CDD:299845 12/71 (17%)
IGc2 400..459 CDD:197706 17/97 (18%)
FN3 719..798 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.