DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAPBPL and side-II

DIOPT Version :9

Sequence 1:NP_060479.3 Gene:TAPBPL / 55080 HGNCID:30683 Length:468 Species:Homo sapiens
Sequence 2:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster


Alignment Length:410 Identity:83/410 - (20%)
Similarity:122/410 - (29%) Gaps:161/410 - (39%)


- Green bases have known domain annotations that are detailed below.


Human    83 GGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT--CEISRYFLQMTE--TTVKTAAWFM 143
            ||..::|..  :....:|.|:             ||.|:  |.|       ||  ..|....||.
  Fly    43 GGISSKDSH--VKTKDIDAVE-------------GKSVSLPCPI-------TEPLDNVYMVLWFR 85

Human   144 ANMQVSGGGPSISLVMK------------TPRVTKNEALWH-----PTLNLPLSPQGTVRTAVEF 191
            .|    .|.|..|..::            .|.|..:.|.:|     .||.:....||..|..|:|
  Fly    86 DN----AGIPLYSFDVRDKESREQPRHWSAPEVFGSRAKFHFDSQPATLEIKRHDQGIYRCRVDF 146

Human   192 QVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLE 256
            :. :||||..|.|        ...:.|...:|...|     || ||             .|..|.
  Fly   147 RT-SQTQSFRFNL--------SVIILPEQPIIMDRW-----GR-QL-------------NGTQLG 183

Human   257 PAQLGMARDASLT---------------LPGLTIQDE------------------------GTYI 282
            |.|.|  .|..:|               :.||.:.::                        ..:.
  Fly   184 PKQEG--DDIVITCRVVGGRPQPQVRWLVNGLLVDNQNEHNSGDVIENRLLWPSVQRNDLNSVFT 246

Human   283 CQITTSLYRAQQIIQLNIQA-SPKVRLSLANEALLPTLI------------------CDIAGYYP 328
            ||            .||.|. .||.:..:.:..|.|.::                  |:.:|..|
  Fly   247 CQ------------ALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGSRP 299

Human   329 LDVVVTW--TREELGGSPAQVSGASFSSLRQSVAGTYSISSSLT--AEPGSAGATYTCQVTHISL 389
             :.::||  .:.:|..:...:|..|..|....|..|.....|:|  ||..:....|.        
  Fly   300 -NAIITWYKGKRQLRRTKDDISKNSTRSELSFVPTTDDDGKSITCRAENPNVNGLYL-------- 355

Human   390 EEPLGASTQVVPPERRTALG 409
             |.:.....|.||.....||
  Fly   356 -ETMWKLNVVYPPLVTLRLG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAPBPLNP_060479.3 IG_like 198..300 CDD:214653 23/140 (16%)
Ig 204..300 CDD:299845 20/134 (15%)
IgC_Tapasin_R 266..396 CDD:143248 29/191 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..468
side-IINP_001014485.3 IG_like 55..160 CDD:214653 33/137 (24%)
Ig 57..160 CDD:299845 33/135 (24%)
Ig 188..251 CDD:299845 7/76 (9%)
Ig 289..363 CDD:299845 17/83 (20%)
IG_like 289..351 CDD:214653 15/62 (24%)
Ig_2 376..460 CDD:290606
IG_like 383..454 CDD:214653
Ig 470..548 CDD:299845
IG_like 481..557 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.