DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATG16L1 and BUB3

DIOPT Version :9

Sequence 1:NP_001350671.1 Gene:ATG16L1 / 55054 HGNCID:21498 Length:624 Species:Homo sapiens
Sequence 2:NP_014669.1 Gene:BUB3 / 854191 SGDID:S000005552 Length:341 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:61/324 - (18%)
Similarity:113/324 - (34%) Gaps:87/324 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   327 VPATALCVFDAHDGEVNAVQFSPGSR-------------LLATGGMDR---RVKLWEVFGE--KC 373
            :|:.:|.:..:.||.:...:|...::             ||....:|.   ::.:..|.||  |.
Yeast    20 IPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKV 84

Human   374 EFKGSLS-------GSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYR----LRHTLTGHSGK 427
            :..||.|       .:|.||..| .......|:|||.|....:....:|.    ....|..::.|
Yeast    85 DLIGSPSFQALTNNEANLGICRI-CKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTK 148

Human   428 VLSAKFLLD--NARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRF 490
            |.:..|.:|  ::|::.|.::..:: |           |....|.|                   
Yeast   149 VKNKIFTMDTNSSRLIVGMNNSQVQ-W-----------FRLPLCED------------------- 182

Human   491 WDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDL------RTNAIKQTFSAPGFK 549
                ....:.|..|..:|..:.|.|:..|..:||..|....::.      ..|:.|:.    .|:
Yeast   183 ----DNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRF----AFR 239

Human   550 C----------GSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWS 603
            |          ......:.|||...::....::|.:..|::.|.|..|..:|.:..|:..:|.|
Yeast   240 CHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATG16L1NP_001350671.1 ATG16 31..206 CDD:312208
WD40 <272..390 CDD:225201 18/87 (21%)
WD40 332..622 CDD:238121 60/319 (19%)
WD40 repeat 344..381 CDD:293791 11/61 (18%)
WD40 repeat 387..423 CDD:293791 8/39 (21%)
WD40 repeat 428..465 CDD:293791 6/38 (16%)
WD40 repeat 473..503 CDD:293791 1/29 (3%)
WD40 repeat 508..544 CDD:293791 9/41 (22%)
WD40 repeat 554..590 CDD:293791 8/35 (23%)
WD40 repeat 597..621 CDD:293791 2/7 (29%)
BUB3NP_014669.1 WD40 <2..317 CDD:225201 61/324 (19%)
WD40 repeat 14..55 CDD:293791 5/34 (15%)
WD40 repeat 60..97 CDD:293791 9/36 (25%)
WD40 repeat 104..143 CDD:293791 8/39 (21%)
WD40 repeat 154..189 CDD:293791 8/69 (12%)
WD40 repeat 196..239 CDD:293791 9/46 (20%)
WD40 repeat 254..290 CDD:293791 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.