DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment timm10b and Tim9b

DIOPT Version :9

Sequence 1:NP_001017829.1 Gene:timm10b / 550527 ZFINID:ZDB-GENE-050417-370 Length:202 Species:Danio rerio
Sequence 2:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster


Alignment Length:120 Identity:49/120 - (40%)
Similarity:62/120 - (51%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MDPQGQLRNLRDFLLVYNRMTEICFHRCSSNFNYRNLTMDEERCVDSCAGKLIRTNHRLMGTYVQ 65
            ||  ..||||:||..:||::||:||.||..|.:.|:|...|:.|||.|..|..|.|..:|..||.
  Fly     1 MD--SNLRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVD 63

Zfish    66 LMPAMVQKRMQEMESKA--AEMAKAEAE-----AAAKAGTSVPDNPSSAITNASM 113
            :...:..|||:|||..|  ||..:.|.|     .||......|..|..| .|.||
  Fly    64 VQTTINAKRMEEMEENARKAEQQQREQEKERLKEAAATAVLTPVQPPVA-GNLSM 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
timm10bNP_001017829.1 zf-Tim10_DDP 6..63 CDD:281019 26/56 (46%)
Twin CX3C motif 24..48 11/23 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..202
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 26/56 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574755
Domainoid 1 1.000 62 1.000 Domainoid score I10366
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5223
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007069
OrthoInspector 1 1.000 - - oto41164
orthoMCL 1 0.900 - - OOG6_110413
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4783
SonicParanoid 1 1.000 - - X5153
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.