DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STX17 and Syx7

DIOPT Version :9

Sequence 1:NP_060389.2 Gene:STX17 / 55014 HGNCID:11432 Length:302 Species:Homo sapiens
Sequence 2:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster


Alignment Length:245 Identity:56/245 - (22%)
Similarity:100/245 - (40%) Gaps:62/245 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    24 VIPTDLERLRKHQINIEKYQRC-----------RIWDKLHEEHINAGRTVQQLRSNIREIEKLC- 76
            :|.|.::::   |.|:...||.           .:..:||:......:.|....:.|.|::| | 
  Fly    29 IIATSIQKV---QQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEVDK-CK 89

Human    77 ---LKVRKDDLVLLKRMIDPVKEEASAATAEF--LQLHLESVEE--LKKQFNDEETLLQPPLTRS 134
               ||:::|.||          :|.:||...|  :|.....:|:  |::...|...:.:||    
  Fly    90 ERHLKIQRDRLV----------DEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPP---- 140

Human   135 MTVGGAFHT--TEAEASSQ---------------SLTQIYALPEIPQDQNAAESWE----TLEAD 178
                |:..|  :.:.||.|               :..|:....|...|..|.|..|    .||.:
  Fly   141 ----GSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELENN 201

Human   179 LIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYK 228
            ::.::::......||..|...:|||...|...::.|.:||:||.||:.|:
  Fly   202 IVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STX17NP_060389.2 COG5325 2..228 CDD:227635 55/243 (23%)
SNARE_syntaxin17 162..223 CDD:277199 18/64 (28%)
Necessary and sufficient for localization to autophagosome. /evidence=ECO:0000269|PubMed:23217709 229..275 56/245 (23%)
Endoplasmic reticulum retention signal. /evidence=ECO:0000255 299..302
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 24/109 (22%)
COG5325 <97..276 CDD:227635 41/173 (24%)
SNARE 188..247 CDD:304603 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.