DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CC and CanA-14F

DIOPT Version :9

Sequence 1:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens
Sequence 2:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster


Alignment Length:305 Identity:114/305 - (37%)
Similarity:177/305 - (58%) Gaps:28/305 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    16 LLEVRGSKPGKNV---------QLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71
            :.:.|..||..:|         :::|:....:..:...:..::..::::|||:.:|||||||:||
  Fly   107 VFDARTGKPQHDVLKQHFILEGRIEESAALRIIQEGATLLRTEKTMIDIEAPVTVCGDIHGQFYD 171

Human    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136
            |::|||.||.|..:.|||||||||||..|:|.:..|.:.||.||:..|||||||||..:...:.|
  Fly   172 LMKLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTF 236

Human   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201
            ..|||.:|:.:::....|.|:|||:||:::::..|.||||||::..:|.|||:.|..:.|..|.:
  Fly   237 KQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPM 301

Human   202 CDLLWSDPDKDVLGWGEND-------RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA 259
            ||||||||.:|......:|       ||.|:.:.......||..::|..|.|||:..:.||..:.
  Fly   302 CDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYR 366

Human   260 KRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM------CS 292
            |.|      |:|:||||||...::|..|::..:..:|      ||
  Fly   367 KSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 114/305 (37%)
MPP_PP1_PPKL 8..298 CDD:277359 114/305 (37%)
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 112/297 (38%)
PP2Ac 132..403 CDD:197547 107/270 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.