DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPP1CC and PpD3

DIOPT Version :9

Sequence 1:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens
Sequence 2:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster


Alignment Length:274 Identity:116/274 - (42%)
Similarity:163/274 - (59%) Gaps:13/274 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    48 SQPILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLL 107
            :||.|:::..|    ..||||||||:|||:.:||..|.|.|.| |||.||:||||..|:|.|..|
  Fly   244 AQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTL 308

Human   108 LAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCC 172
            ..:|:.||.:|||.|||||..::|::|||..|...:|...:...||..||.||:...:::||...
  Fly   309 FGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVM 373

Human   173 HGGL-SPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFL 236
            |||| |.:..:::.||||.|....|::||:|:|||||| :..:|.|::.|||...||.:|..||.
  Fly   374 HGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDP-QQWMGLGQSKRGVGIQFGPDVTEKFC 437

Human   237 HKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEK 301
            ..::||.|.|:|:|.:.|||.....:.:|:|||||||....|.||.:::      :...|||..|
  Fly   438 KDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITI------TGNNLKPNYK 496

Human   302 KKPNATRPVTPPRA 315
            .......|...|.|
  Fly   497 SFEAVPHPDVKPMA 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 115/272 (42%)
MPP_PP1_PPKL 8..298 CDD:277359 110/255 (43%)
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 116/274 (42%)
PP2Ac 226..502 CDD:197547 113/264 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.